Search PubMed⌕ Search

SEARCH · Search PubMed

Results for “Viola”

Search indexed PubMed citations on genomics, clinical trials, systematic reviews and public health. Explore titles, authors and supplied subject terms, then open the PubMed record.

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 19 recordsLinked to original sources

The effect of sativan from Viola verecunda A. Gray on the expressions of matrix metalloproteinase-1 caused by ultraviolet irradiated cultured primary human skin fibroblasts.

Matrix metalloproteinases (MMPs) are a family of enzymes whose main function is degradation of the extracellular matrix. Matrix metalloproteinase-1 (MMP-1) degrades type I procollagen constituting the major structural component of the basement membrane and extra cellular membrane. The enzymatic activity is found to be elevated in photoaging. With the aim of finding novel MMP-1 inhibitors from natural products, 15 extracts of the Viola taxa, which are used as prescriptions for skin eruption treatment in traditional medicine, were screened for their inhibitory activities towards MMP-1. Among the 15 tested materials, the methanol extracts of Viola hondoensis W. BECKER et H. BOISS, Viola ibukiana MAKINO, Viola lactiflora NAKAI and Viola verecunda A. GRAY were potential inhibitory to MMP-1, and other Viola taxa showed a weak inhibitory effect at a concentration of 100 microg/ml. We investigated the effect of MMP-1 inhibitory of the solvent fractions of the same plants (Viola hondoensis, Viola ibukiana and Viola verecunda). Therefore, a strong inhibition was found in the ethylacetate fractions of Viola verecunda with inhibitory activity (>90%) at a concentration of 10 microg/ml. Here we investigated the effect of sativan isolated from the ethylacetate fractions of Viola verecunda on the expression of MMPs in UV-irradiated human skin fibroblasts in vitro. Sativan markedly reduced UV-induced MMP-1 expression at the protein levels in a dose-dependent manner. Our report is the first description for the ability of sativan to regulate UV-induced MMP-1 expression.

Cells, Cultured↗

Floral biology and pollination mechanisms in two Viola species--from nectar to pollen flowers?

The genus Viola is represented by four related species in Brazil belonging to section Leptidium, one of the most primitive sections in the genus. Floral biology and pollination by bees were studied in Viola cerasifolia and V. subdimidiata in high-altitude areas in south-eastern Brazil. Flowers are zygomorphic and spurred. The five stamens are arranged in a cuff around the ovary, and pollen is released by means of apical connective projections, which form a cone surrounding the base of the style. The connective projections of the inferior stamens are elongated and curved to form a hook-shaped structure. Nectar-secreting tissue can occur in the basal connective appendages of the inferior stamens, which project into the spur. Flowers of V. subdimidiata secreted a mean volume of 0.14 micro l nectar over a 24-h period; approx. 40 % of flowers did not secrete any nectar. The main pollinators of these Viola species are female bees belonging to the genus Anthrenoides (Andrenidae), which search mainly for pollen. These bees seem to be oligolectic and obtain large amounts of pollen from Viola by vibrating the flowers or by moving the hook repeatedly back and forth. Males of Anthrenoides patrol Viola clusters and also feed on nectar, acting as secondary pollinators. The basic floral structure in the genus Viola fits that of 'nectar flowers'. The uncommon hook-shaped projections, scanty nectar production, and behaviour of pollinators suggest that V. cerasifolia and V. subdimidiata are shifting their reward for pollinators from nectar to pollen. Based on floral morphology, this shift may be widespread in Viola sect. Leptidium.

Animals↗

Accuracy of predicted ear canal speech levels using the VIOLA input/output-based fitting strategy.

OBJECTIVE: The Visual Input/Output Locator Algorithm (VIOLA) is a software-assisted method for prescribing amplification targets and selecting a hearing aid to match the targets. Although the procedure calls for selection and fitting of hearing aids in terms of their pure-tone input/output functions in a coupler, it is assumed that a hearing aid that matches the coupler prescription targets will produce specific amplified speech levels in the patient's ear canal. This investigation evaluated the validity of that assumption. DESIGN: Six hearing aids were evaluated. They were representative of linear and compression processing as well as single- and 2-channel designs. The "subject" was a KEMAR manikin with realistic assumed hearing loss and loudness perception characteristics. Each hearing aid was configured to match the subject's VIOLA prescription as closely as possible. Predicted ear canal speech levels were determined using the prescription rules and modified by the differences between coupler prescription targets and coupler performance of the actual hearing aids. With the subject wearing each hearing aid coupled to an unvented earmold, continuous speech was presented in the sound field and measured, after amplification, in the ear canal. The match between observed and predicted levels of amplified speech indicated the validity of the VIOLA assumptions under examination. RESULTS: The match between predicted and observed levels was good for soft speech input levels. As speech input levels increased, the differences between observed and predicted levels also increased, with the largest differences seen for loud speech inputs. When differences were seen between observed and predicted levels, they were always in the direction of lower than predicted ear canal levels. The differences between observed and predicted levels were attributed to the effects of limiting, effects of compression ratio in wide range compression, the individual subject's field-to-microphone transfer function, and the subject's individual real-ear-to-coupler level difference. CONCLUSIONS: Ear canal speech levels were reasonably close to predicted values, and the deviations from predicted levels were plausibly accounted for by consideration of hearing aid performance. Thus, the approach used by the VIOLA procedure holds considerable promise for extending clinical control over the complex and interactive parameters of nonlinear hearing aids. The results of this study indicate that selection and fitting of hearing aids using the current VIOLA procedure usually will result in the generation of lower than predicted ear canal speech levels, especially for loud speech inputs. However, the accuracy of the procedure could be improved substantially by modification of the software to account for the effects of limiting and those of the compression ratio in systems with compression thresholds lower than the level of unamplified loud speech.

Ear Canal↗

Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1.

The plant cyclotides are a family of 28 to 37 amino acid miniproteins characterized by their head-to-tail cyclized peptide backbone and six absolutely conserved Cys residues arranged in a cystine knot motif: two disulfide bonds and the connecting backbone segments form a loop that is penetrated by the third disulfide bond. This knotted disulfide arrangement, together with the cyclic peptide backbone, renders the cyclotides extremely stable against enzymatic digest as well as thermal degradation, making them interesting targets for both pharmaceutical and agrochemical applications. We have examined the expression patterns of these fascinating peptides in various Viola species (Violaceae). All tissue types examined contained complex mixtures of cyclotides, with individual profiles differing significantly. We provide evidence for at least 57 novel cyclotides present in a single Viola species (Viola hederacea). Furthermore, we have isolated one cyclotide expressed only in underground parts of V. hederacea and characterized its primary and three-dimensional structure. We propose that cyclotides constitute a new family of plant defense peptides, which might constitute an even larger and, in their biological function, more diverse family than the well-known plant defensins.

Amino Acid Sequence↗

Antiplasmodial activity of triterpenoid isolated from whole plants of Viola genus from South Korea.

Species of the Viola genus, used in traditional medicines for the treatment of parasites, were collected and petroleum ether extract was obtained by sonication. The antiplasmodial activity of petroleum ether extracts was evaluated in vitro against the chloroquine-resistant FcB1 strain of Plasmodium falciparum. Bioactivity-guided fractionation of the petroleum ether extracts of the whole plants of Viola verecunda has led to the isolation of epi-oleanolic acid, a triterpenoid, displaying high antiplasmodial activity (IC(50) 0.18 mug/ml). This is the first report of the isolation and antiplasmodial activity of epi-oleanolic acid from this species.

Animals↗

Variations in cyclotide expression in viola species.

Cyclotides, a family of approximately 50 mini-proteins isolated from various Violaceae and Rubiaceae plants, are characterized by their circular peptide backbone and six conserved cysteine residues arranged in a cystine knot motif. Cyclotides show a wide range of biological activities, making them interesting targets for both pharmaceutical and agrochemical research, but little is known about their natural function and the events that trigger their expression. An investigation of the geographical and seasonal variations of cyclotide profiles has been performed, using the native Australian violet, Viola hederacea, and the Swedish sweet violet, Viola odorata, as model plants. The results showed that in the Australian violet the relative peptide levels of some cyclotides remained almost constant throughout the year, while other cyclotides were present only at certain times of the year. Therefore, it appears that V. hederacea expresses a basic armory of cyclotides as well as special "add-ons" whose levels are influenced by external factors. In the Swedish violet, cyclotide levels were increased up to 14 times during the warmest period of the year. The larger variation in expression levels of the Swedish plants may be a reflection of a greater climatic variation.

Amino Acid Sequence↗

Population genetic structure of the cleistogamous plant species Viola pubescens Aiton (Violaceae), as indicated by allozyme and ISSR molecular markers.

Few studies of genetic variation have focused on species that reproduce through both showy, chasmogamous (CH) flowers and self-pollinated, cleistogamous (CL) flowers. Using two different techniques, genetic variation was measured in six populations of Viola pubescens Aiton, a yellow-flowered violet found in the temperate forests of eastern North America. Results from eight allozyme loci showed that there was considerable genetic variation in the species, and population structuring was indicated by the presence of unique alleles and a theta (F(ST)) value of 0.29. High genetic variation was also found using ISSR (inter-simple sequence repeat) markers, and population structuring was again evident with unique bands. Viola pubescens appears to have a true mixed-mating system in which selfing through CL and CH flowers contributes to population differentiation, and outcrossing through CH flowers increases genetic variation and gene flow among populations. Overall, allozyme and ISSR techniques yielded similar results, indicating that ISSR markers show potential for use in population genetic studies.

Alleles↗

The effect of professional violin and viola playing on the bony facial structures.

Professional violin and viola playing involves a particular kind of asymmetric face, neck and shoulder muscle activity. The aim of this study was to find out whether players' facial morphology is influenced by this occupational orofacial muscle activity. Lateral and posteroanterior cephalograms and panoramic tomograms of 26 adult professional violin and viola players were evaluated and compared with those of age, sex and dentition matched controls. Significant differences were found between the players and the controls. The players had smaller facial heights, more proclined maxillary incisors and greater mandibular lengths. Thus, intense long-term violin/viola playing has the effect of modifying facial morphology.

Adult↗

Evolution and biogeography of the woody Hawaiian violets (Viola, Violaceae): arctic origins, herbaceous ancestry and bird dispersal.

Specialists studying the genus Viola have consistently allied the Hawaiian violets comprising section Nosphinium--most of which are subshrubs or treelets--with putatively primitive subshrubs in certain South American violet groups. Hawaiian violets also possess inflorescences, a floral disposition otherwise found only in other genera of the Violaceae, thus strengthening the hypothesis of a very ancient origin for the Hawaiian species. A survey of phylogenetic relationships among infrageneric groups of Viola worldwide using nuclear rDNA internal transcribed spacer (ITS) sequences revealed a dramatically different biogeographic origin for the Hawaiian violets: A monophyletic Hawaiian clade was placed in a close sister relationship with the amphi-Beringian tundra violet, V. langsdorffii s. 1., in a highly derived position. This remarkable and unforeseen relationship received strong clade support values across analyses, and monophyly of the Hawaiian lineage was further indicated by a unique 26-base-pair deletion in section Nosphinium. The high polyploid base chromosome number (n approximately equal to 40) in the Hawaiian violets relates them to Alaskan and eastern Siberian populations in the polyploid V. langsdorffii complex. More than 50 species of the 260 allochthonous birds wintering in the Hawaiian Islands are found to breed in the Arctic, occupying habitats in which individual birds might have encountered ancestral V. langsdorffii populations and served as dispersers to the central Pacific region. Acquisition of derived morphological traits (e.g., arborescence and inflorescences), significance of a confirmed Arctic origin for a component of the Hawaiian flora, and the likelihood of other "cryptic" Arctic elements in the Hawaiian flora deserving independent molecular phylogenetic corroboration are discussed.

Animals↗

Signs and symptoms of temporomandibular disorders and radiologically observed abnormalities in the condyles of the temporomandibular joints of professional violin and viola players.

The frequency of temporomandibular disorders (TMDs) and radiologically observed abnormalities in the condyles of the temporomandibular joints (TMJs) of professional violin and viola players was investigated in 26 orchestra violinists/violists (VP group) and in their sex-, age-, and dentition-matched controls (C group). A routine clinical stomatognathic examination, a standardized interview, and radiography of the condyles were carried out for all subjects. The VP group showed a higher frequency of subjective symptoms and clinical signs of TMD, such as palpatory tenderness of masticatory muscles, TMJ clicking, painful mandibular movements, and deviation on opening or closing. There was no difference between the groups in terms of radiologic findings in the condyles. Weekly playing hours correlated positively with some signs of TMD. It is concluded that professional violin or viola playing might be a predisposing factor for TMD.

Adult↗

Matrix metalloproteinase-1 expression inhibitory compound from the whole plants of Viola ibukiana Makino.

Bioassay-guided fractionation has led to the isolation of two triterpenoid saponins 3-O-[O-beta-D-glucopyranosyl-(1 --> 3)-O-beta-D-glucopyranosyl] oleanolic acid (1), and 3-O-[O-beta-D-glucopyranosyl-(1 --> 2)-O-beta-D-glucopyranosyl] oleanolic acid (2) from the whole plants of Viola ibukiana Makino. Compound 2 showed matrix metalloproteinase-1 expression inhibition activities in a dose-dependent manner.

Blotting, Western↗

Triterpenoid saponin from Viola hondoensis W. Becker et H Boss. and their effect on MMP-1 and type I procollagen expression.

Bioassay-guided fractionation has led to the isolation of triterpenoid saponins such as Acutoside A (3-omicron-[omicron-beta-D-glucopyranosyl-(1 --> 2)-omicron-beta-D-glucopyranosyl] oleanolic acid) from the whole plants of Viola hondoensis. Among them, Saponin 1 exhibited potent inhibitory activity against matrix metalloproteinase (MMP)-1, and prevented the UV-induced changes in the MMP-1 expression. In addition, compound was isolated from this plant for the first time.

Blotting, Western↗

Antimicrobial activity of Viola tricolor herb.

The antimicrobial activity of infusion, decoction, ethanol extract and fractions obtained by successive extraction of Viola tricolor herb with dichloromethane, ethyl acetate and methanol was evaluated. The infusion, decoction and ethanol extract were found to be most effective against the tested microorganisms.

Anti-Infective Agents↗

Discovery and characterization of a linear cyclotide from Viola odorata: implications for the processing of circular proteins.

Cyclotides are mini-proteins of 28-37 amino acid residues that have the unusual feature of a head-to-tail cyclic backbone surrounding a cystine knot. This molecular architecture gives the cyclotides heightened resistance to thermal, chemical and enzymatic degradation and has prompted investigations into their use as scaffolds in peptide therapeutics. There are now more than 80 reported cyclotide sequences from plants in the families Rubiaceae, Violaceae and Cucurbitaceae, with a wide variety of biological activities observed. However, potentially limiting the development of cyclotide-based therapeutics is a lack of understanding of the mechanism by which these peptides are cyclized in vivo. Until now, no linear versions of cyclotides have been reported, limiting our understanding of the cyclization mechanism. This study reports the discovery of a naturally occurring linear cyclotide, violacin A, from the plant Viola odorata and discusses the implications for in vivo cyclization of peptides. The elucidation of the cDNA clone of violacin A revealed a point mutation that introduces a stop codon, which inhibits the translation of a key Asn residue that is thought to be required for cyclization. The three-dimensional solution structure of violacin A was determined and found to adopt the cystine knot fold of native cyclotides. Enzymatic stability assays on violacin A indicate that despite an increase in the flexibility of the structure relative to cyclic counterparts, the cystine knot preserves the overall stability of the molecule.

Amino Acid Sequence↗

Expression of Viola cyclotides by liquid chromatography-mass spectrometry and tandem mass spectrometry sequencing of intercysteine loops after introduction of charges and cleavage sites by aminoethylation.

The expression of cyclotides-macrocyclic plant peptides-was profiled in six violets, Viola cotyledon, V. biflora, V. arvensis, V. tricolor, V. riviniana, and V. odorata, by LC-MS. All were found to express notably complex mixtures, with single species containing >50 cyclotides. To facilitate their sequencing by MS-MS, an analytical strategy is presented involving aminoethylation of cysteines. This overcomes a number of problems intimately associated with the cyclotide core structure-that is, their joined N and C termini, disulfide knot, and low or clustered content of positively charged amino acids and enzymatic cleavage sites. As a result, charges as well as cleavage sites are introduced at the most conserved part of their sequence, the cysteines. Combined with tryptic digestion, all intercysteine loops are then of suitable size and charge for MS-MS sequencing. The utility of this strategy is shown by the sequencing of two novel cyclotides isolated from V. cotyledon; vico A (cyclo-(AESCVYIPCFTGIAGCSCKNKVCYYNGSIPC)) and vico B (cyclo-(AESCVYIPCITGIAGCSCKNKVCYYNGSIPC)); their complete sequence could be determined by nanospray MS-MS. The strategy for converting conserved cysteines to enzymatic cleavage sites might also benefit the study of other peptides and proteins displaying similar structural problems for MS analysis.

Amino Acid Sequence↗

Primary and 3-D modelled structures of two cyclotides from Viola odorata.

Two polypeptides named vodo M and vodo N, both of 29 amino acids, have been isolated from Viola odorata L. (Violaceae) using ion exchange chromatography and reversed phase HPLC. The sequences were determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry (MS). Using MS, it was established that vodo M (cyclo-SWPVCTRNGAPICGESCFTGKCYTVQCSC) and vodo N (cyclo-SWPVCYRNGLPVCGETCTLGKCYTAGCSC) form a head-to-tail cyclic backbone and that six cysteine residues are involved in three disulphide bonds. Their origin, sequences, and cyclic nature suggest that these peptides belong to the family of cyclic plant peptides, called cyclotides. The three-dimensional structures of vodo M and vodo N were modelled by homology, using the experimentally determined structure of the cyclotide kalata B1 as the template. The images of vodo M and vodo N show amphipathic structures with considerable surface hydrophobicity for a protein modelled in a polar environment.

Amino Acid Sequence↗

Cytotoxic cyclotides from Viola tricolor.

A crude fraction of Viola tricolor rich in small lipophilic proteins was prepared and subjected to fractionation guided by bioactivity, using RP-HPLC and a fluorometric cytotoxicity assay. Two human cancer cell lines, U-937 GTB (lymphoma) and RPMI-8226/s (myeloma), were used in this study. The most potent compounds isolated, that is, the compounds showing the lowest IC(50) values, were shown to be three small proteins: vitri A (IC(50) = 0.6 microM and IC(50) = 1 microM, respectively), varv A (IC(50) = 6 microM and IC(50) = 3 microM, respectively), and varv E (IC(50) = 4 microM in both cell lines). Their sequences, determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry, were cyclo-GESCVWIPCITSAIGCSCKSKVCYRNGIPC (vitri A), cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPVC (varv A), and cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPIC (varv E), of which vitri A is described for the first time. Each forms a head-to-tail cyclic backbone, with six cysteine residues being involved in three disulfide bonds, characteristic of the family of small proteins called the cyclotides. This is the first report on cyclotides from the species V. tricolor and the first report on the sequence of the cytotoxic cyclotide vitri A.

Amino Acid Sequence↗