Search PubMed⌕ Search

SEARCH · Search PubMed

Results for “PETROLEUM PRODUCTS”

Search indexed PubMed citations on genomics, clinical trials, systematic reviews and public health. Explore titles, authors and supplied subject terms, then open the PubMed record.

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 883 records · Page 49Linked to original sources
PubMedDate not supplied

14C-sorbic acid distribution in the aqueous and non-aqueous extracts of cooked millet dough (fura).

Millet flour was used to prepare the West African food, fura, preserved with sorbic acid. The lipid and protein fractions which appeared to bind sorbic acid or its degradation products were identified with the help of 14C-sorbic acid. Fractionation of the lipids and proteins from fura showed the 14C to be associated with the petroleum spirit crude fat extract (28 +/- 5%), the water-soluble (6.2 +/- 0.7%), the ethanol-soluble (4.5 +/- 0.7%), the salt-soluble (3.5 +/- 0.6%) and the acetic acid-soluble components (0.9 +/- 0.3%). Dialysis of the ethanol-, salt- and acetic acid-soluble fractions suggested that 14C activity tended to be associated with the low molecular weight components of these fractions.

Acetates↗
PubMed2006

Catalytic alkane metathesis by tandem alkane dehydrogenation-olefin metathesis.

With petroleum supplies dwindling, there is increasing interest in selective methods for transforming other carbon feedstocks into hydrocarbons suitable for transportation fuel. We report the development of highly productive, well-defined, tandem catalytic systems for the metathesis of n-alkanes. Each system comprises one molecular catalyst (a "pincer"-ligated iridium complex) that effects alkane dehydrogenation and olefin hydrogenation, plus a second catalyst (molecular or solid-phase) for olefin metathesis. The systems all show complete selectivity for linear (n-alkane) product. We report one example that achieves selectivity with respect to the distribution of product molecular weights, in which n-decane is the predominant high-molecular-weight product of the metathesis of two moles of n-hexane.

Journal Article↗
PubMed2000

Purification and characterization of dibenzothiophene sulfone monooxygenase and FMN-dependent NADH oxidoreductase from the thermophilic bacterium Paenibacillus sp. strain A11-2.

A dibenzothiophene (DBT) sulfone monooxygenase (TdsA), which catalyses the oxidative CS bond cleavage of DBT sulfone to produce 2-(2-hydroxyphenyl)benzenesulfinate (HPBS) was purified from the thermophilic DBT desulfurizing bacterium Paenibacillus sp. strain A11-2 by multistep chromatography. The molecular mass of the purified enzyme was determined to be 120 kDa by gel filtration and the subunit molecular mass was calculated to be 48 kDa by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) indicating a dimeric structure. The N-terminal amino acid sequence of the purified TdsA was determined to be MRQMHLAGFFAAGNTHH, which revealed no significant similarity to any other known amino acid sequences. The purified TdsA absolutely required an oxidoreductase for its activity. This oxidoreductase (TdsD) was also purified to homogeneity, and its molecular size was calculated to be 50 kDa and 25 kDa by gel filtration and SDS-PAGE, respectively. TdsD was completely FMN-dependent, and FAD could not act as a cofactor. The N-terminal amino acid sequence of the purified TdsD was determined to be TSQTAEQSIAPIVAQYRHPEQPISALFVNR, which showed significant similarity to kinesin-like protein (44% identity). The optimal temperatures for the activity of TdsA and TdsD were 45 degrees C and 55 degrees C, respectively. Both enzymes showed optimal activity at pH 5.5. TdsA was slightly inhibited by sulfate, but not by 2-hydroxybiphenyl (2-HBP), which is another end product of DBT. TdsA showed higher activity toward bulkier substrates than its mesophilic counterpart, DszA. These properties suggest the applicability of biodesulfurization to the processing of actual petroleum fractions.

Journal Article↗
PubMedDate not supplied

Results of an indoor air pollution investigation.

After the opening of a new elementary school in fall 1986, several members of the school's staff noticed symptoms they attributed to the workplace. An investigation by the Occupational Safety and Health Branch (OSHA) of the Alaska Department of Labor found no major health problems and concluded that fireproofing at the school may have caused a petroleum-like odor. In fall 1987, parents reported illness in their children that they attributed to school attendance. Subsequent epidemiologic investigation found that student and staff absentee rates were not increased and were similar to other schools in the district. Testing conducted by the National Institute for Occupational Safety and Health (NIOSH) confirmed that the petroleum-like odor was due to the fireproofing. Toxicologic information and the results of air sampling confirmed that no adverse health effects would be expected from the product. By working together with NIOSH, OSHA, the school district, and a consulting mechanical engineer, deficiencies in the school's ventilation system were discovered and immediately corrected with interim engineering changes. Only by bringing multiple agencies together and openly sharing findings with concerned parents and staff were the problems at the school resolved.

Absenteeism↗
PubMedDate not supplied

[Poisoning caused by Eau Ecarlate: apropos of a fatal case in a child].

A 19 months child was accidentally poisoned by ingestion of "eau écarlate", a gasoline-based cleaner. He died half an hour later with an acute pulmonary necrosis, caused by inhalation of gasoline. The authors describe the toxicity of petroleum poisoning and attempt to edict standards for medical transportation of children with petroleum accidental absorption.

Alkanes↗
PubMed2004

Pentadiene production from potassium sorbate by osmotolerant yeasts.

Some yeast strains belonging to the species Zygosaccharomyces rouxii and Debaryomyces hansenii are capable of spoiling sorbate containing high-sugar foods by producing pentadiene, a volatile compound reported to have 'petroleum-like' odour. Quantification of the diminution of sorbate and the subsequent increase of pentadiene was performed by growing the yeasts in experimental media containing 600 g/l sucrose and different sorbate concentrations. Final sorbate concentrations were notably lower than their corresponding initial ones, and it was found that the higher the initial concentration of sorbate in the media, the higher the amount of pentadiene produced. In all cases, Z. rouxii was able to produce more pentadiene than D. hansenii when expressing pentadiene concentration as a function of cell biomass. These results suggest that pentadiene is a metabolite of sorbate.

Alkadienes↗
PubMed2006

Microbial biocatalyst developments to upgrade fossil fuels.

Steady increases in the average sulfur content of petroleum and stricter environmental regulations concerning the sulfur content have promoted studies of bioprocessing to upgrade fossil fuels. Bioprocesses can potentially provide a solution to the need for improved and expanded fuel upgrading worldwide, because bioprocesses for fuel upgrading do not require hydrogen and produce far less carbon dioxide than thermochemical processes. Recent advances have demonstrated that biodesulfurization is capable of removing sulfur from hydrotreated diesel to yield a product with an ultra-low sulfur concentration that meets current environmental regulations. However, the technology has not yet progressed beyond laboratory-scale testing, as more efficient biocatalysts are needed. Genetic studies to obtain improved biocatalysts for the selective removal of sulfur and nitrogen from petroleum provide the focus of current research efforts.

Fossil Fuels↗
PubMed1975

Determination of hexachlorobenzene and mirex in fatty products.

A procedure is described for the isolation and cleanup of hexachlorobenzene (HCB) and mirex in fats and oils for gas-liquid chromatographic (GLC) analysis. The fat or oil is distributed on unactivated Florisil, and the HCB and mirex are eluted with acetonitrile. The pesticides are then partitioned into petroleum ether. Elution through activated Florisil with methylene chloride-hexane (20+80) is used for the final cleanup. HCB and mirex are then measured by GLC, using the appropriate electron capture conditions with a 15% OV-210 column for HCB and a 3% OV-101 column for mirex. The method demonstrates recoveries greater than 90% for HCB and mirex and allows screening at or below the 0.1 ppm level in fats with a 3 mg fat injection.

Animal Feed↗
PubMed2003

Total dissolved and particulate lead in the Western Harbor of Alexandria, a Mediterranean basin under stress.

The Western Harbor of Alexandria, the largest harbor of Egypt on the Mediterranean Sea, receives different internal and external untreated pollutants affecting dramatically its water, sediments and biota. Surface and bottom water samples were collected bimonthly from this harbor for studying vertical, regional and monthly distributions of total suspended matter (TSM), total dissolved lead (TDPb) and total particulate lead (TPPb). The high surface TSM values coincided with air-borne dust, organic aggregates, plankton productivity and discharged wastes. The high TSM averages in winter resulted mainly from turbulence of the water column by wind action. The highest averages of TDPb in the petroleum and coal basins in the Western Harbor reflect their effects on the water column, while the lowest averages of TDPb and TPPb were found at a location far away from pollution sources. For the water column, the maximum and minimum monthly averages of TPPb and TDPb respectively in June reflect the increase in the rate of lead uptake by phytoplankton abundant in summer, favored by temperature elevation. The annual mean concentration of TPPb was nearly double that of TDPb, indicating that lead was transported to the Western Harbor mainly in particulate form. This reflects the high TSM content in the harbor water onto which a considerable part of lead was adsorbed.

Adsorption↗
PubMed2005

Polyacetylenic compounds, ACAT inhibitors from the roots of Panax ginseng.

Acyl-CoA: cholesterol acyltransferase (ACAT), which plays a role in the absorption, storage, and production of cholesterol, has been explored as a potential target for pharmacological intervention of hyperlipidemia and atherosclerotic disease. In our search for ACAT inhibitors from natural sources, the petroleum ether extract of Panax ginseng showed moderate inhibition of ACAT enzyme from rat liver microsomes. Bioactivity-guided fractionations led to the isolation of one new polyacetylenic compound, (9R,10S)-epoxy-16-heptadecene-4, 6-diyne-3-one (1), in addition to the previously reported polyacetylenic compounds 2 and 3. Their chemical structures were elucidated on the basis of spectroscopic evidence (UV, IR, NMR, and MS). The compounds 1, 2, and 3 showed significant ACAT inhibition with IC(50) values of 35, 47, and 21 microM, respectively.

Acetylene↗
PubMed2004

Comparison of conventional gas chromatography and comprehensive two-dimensional gas chromatography for the detailed analysis of petrochemical samples.

Comprehensive two-dimensional gas chromatography (GC x GC) has been investigated for the characterization of high valuable petrochemical samples from dehydrogenation of n-paraffins, Fischer-Tropsch and oligomerization processes. GC x GC separations, performed using a dual-jets CO2 modulator, were optimized using a test mixture representative of the hydrocarbons found in petrochemicals. For complex samples, a comparison of GC x GC qualitative and quantitative results with conventional gas chromatography (1D-GC) has demonstrated an improved resolution power of major importance for the processes: the group type separation has permitted the detection of aromatic compounds in the products from dehydrogenation of n-paraffins and from oligomerization, and the separation of alcohols from other hydrocarbons in Fischer-Tropsch products.

Chromatography, Gas↗
PubMed1995

Channel structures in aerobic biofilms of fixed-film reactors treating contaminated groundwater.

Scanning electron microscopy, confocal scanning laser microscopy, and fatty acid methyl ester profiles were used to study the development, organization, and structure of aerobic multispecies biofilm communities in granular activated-carbon (GAC) fluidized-bed reactors treating petroleum-contaminated groundwaters. The sequential development of biofilm structure was studied in a laboratory reactor fed toluene-amended groundwater and colonized by the indigenous aquifer populations. During the early stages of colonization, microcolonies were observed primarily in crevices and other regions sheltered from hydraulic shear forces. Eventually, these microcolonies grew over the entire surface of the GAC. This growth led to the development of discrete discontinuous multilayer biofilm structures. Cell-free channel-like structures of variable sizes were observed to interconnect the surface film with the deep inner layers. These interconnections appeared to increase the biological surface area per unit volume ratio, which may facilitate transport of substrates into and waste products out of deep regions of the biofilm at rates greater than possible by diffusion alone. These architectural features were also observed in biofilms from four field-scale GAC reactors that were in commercial operation treating petroleum-contaminated groundwaters. These shared features suggest that formation of cell-free channel structures and their maintenance may be a general microbial strategy to deal with the problem of limiting diffusive transport in thick biofilms typical of fluidized-bed reactors.

Aerobiosis↗