Search PubMed⌕ Search

SEARCH · Search PubMed

Results for “Crows”

Search indexed PubMed citations on genomics, clinical trials, systematic reviews and public health. Explore titles, authors and supplied subject terms, then open the PubMed record.

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 73 records · Page 4Linked to original sources
PubMed2003

Direct observations of pandanus-tool manufacture and use by a New Caledonian crow (Corvus moneduloides).

New Caledonian crows are reported to have impressive pandanus-tool manufacture abilities. These claims are based on an extensive artefact record. However, inferring behavioural and cognitive abilities without direct observation of tool manufacture is problematic. Here we report (and document on video) direct observations of a crow making and using stepped pandanus tools at Pic Ningua. We observed (1) a bias for making tools on left edges consistent with that previously found at the site, (2) faithful manufacture of a stepped design with high overall congruence in the shapes of tools, (3) the use of convergent rips to first form the tapered end working away from the trunk then the wide end working towards the trunk, (4) appropriate functional use of stepped tools by use of the leaf-edge barbs to hook food from holes, and (5) consistent holding of tools on the left side of its head when using them. Our observations verify most of the claims based on the artefact record, but the crow's exact manufacture technique was slightly different to that inferred previously.

Animals↗
PubMed1984

Differential cerebral speech lateralization in Crow Indian and Anglo children.

Sixty pairs of dichotically presented CV syllables were administered to matched samples of bilingual Native American Crow and monolingual Anglo subjects. While sex and grade were not significant factors, a significant variance was found between the performance of the bilingual Native American Crow and the monolingual Anglo subjects. As predicted (1) the bilingual children demonstrated a more symmetrical cerebral representation for language processing than the monolingual children; and (2) the bilingual primary Crow speakers had a greater right hemisphere involvement in receptive language processing than the monolingual English speakers. Possible factors influencing these results are discussed.

Child↗
PubMed1993

Isolation and primary structure of a novel avian pancreatic polypeptide from five species of Eurasian crow.

Chicken pancreatic polypeptide is the prototype of the neuropeptide Y (NPY)/PP superfamily of regulatory peptides. This polypeptide was appended the descriptive term avian, despite the presence of some 8600 extant species of bird. Additional primary structures from other avian species, including turkey, goose and ostrich, would suggest that the primary structure of this polypeptide has been highly-conserved during avian evolution. Avian pancreatic polypeptides structurally-characterised to date have distinctive primary structural features unique to this vertebrate group including an N-terminal glycyl residue and a histidyl residue at position 34. The crow family, Corvidae, is representative of the order Passeriformes, generally regarded as the most evolutionarily recent and diverse avian taxon. Pancreatic polypeptide has been isolated from pancreatic tissues from five representative Eurasian species (the magpie, Pica pica; the jay, Garrulus glandarius; the hooded crow, Corvus corone; the rook, Corvus frugilegus; the jackdaw, Corvus monedula) and subjected to structural analyses. Mass spectroscopy estimated the molecular mass of each peptide as 4166 +/- 2 Da. The entire primary structures of 36 amino acid residue peptides were established in single gas-phase sequencing runs. The primary structures of pancreatic polypeptides from all species investigated were identical: APAQPAYPGDDAPVEDLLRFYNDLQQYLNVVTRPRY. The peptides were deemed to be amidated due to their full molar cross-reactivity with the amide-requiring PP antiserum employed. The molecular mass (4165.6 Da), calculated from the sequences, was in close agreement with mass spectroscopy estimates. The presence of an N-terminal alanyl residue and a prolyl residue at position 34 differentiates crow PP from counterparts in other avian species.(ABSTRACT TRUNCATED AT 250 WORDS)

Amino Acid Sequence↗
PubMed2004

Detection of West Nile virus using formalin fixed paraffin embedded tissues in crows and horses: quantification of viral transcripts by real-time RT-PCR.

West Nile virus (WNV) RNA was quantified in WNV infected crows and horses with the help of a real-time reverse transcriptase-PCR assay. A 5' nuclease assay, based on NS5 gene detection with a fluorescent probe was used for quantifying WNV RNA using formalin fixed paraffin embedded tissue specimens. Quantitative detection of WNV RNA showed the presence of a higher amount of the viral RNA in crow tissues compared to equine tissues and these results correlated well with the detection of WNV antigen by immunostaining. In crows, the highest amount of virus was seen in the intestine and in horses in the brain.

Animals↗
PubMed1999

Population boundaries and genetic diversity in the endangered Mariana crow (Corvus kubaryi).

The Mariana crow (Corvus kubaryi) is an endangered species that is restricted to the islands of Guam and Rota in the Mariana archipelago. Predation by the introduced brown tree snake (Boiga irregularis) has decimated bird populations on Guam, and the crow population there is the last wild remnant of the endemic forest avifauna. The population on Guam is critically endangered and, despite intensive management, the population has continued to decline. Additional management options include intermixing the Guam and Rota populations, but such options are best evaluated within a population genetics framework. We used three types of molecular markers to assay genetic variation in the Mariana crow: mitochondrial DNA (mtDNA) sequences, minisatellites and microsatellites. The two populations could be differentiated by mtDNA sequencing and they differed in allele frequencies at nuclear markers. Thus, the populations could be designated as evolutionarily significant units. However, the Guam population is genetically more diverse than the Rota population, and its survival probability if managed separately is very low. All markers did indicate that the two populations are closely related and separated by a shallow genealogical division. Intermixing the populations is justified by two rationales. First, the apparent population differences may result from recent human activities. Second, a greater amount of genetic information may be preserved by joint management. The translocation of birds from Rota to Guam has begun, but strategies that will ensure maintenance of the variation in the Guam population warrant further exploration.

Animals↗
PubMed2002

Bilateral, double-blind, randomized comparison of 3 doses of botulinum toxin type A and placebo in patients with crow's feet.

BACKGROUND: Optimum dosing for botulinum toxin type A (BTX-A) in crow's feet remains to be defined. OBJECTIVE: Our purpose was to compare the efficacy and safety of 3 doses of BTX-A and placebo in patients with crow's feet. METHODS: Patients were treated with 6, 12, or 18 units of BTX-A in orbicularis oculi muscle on one side and placebo contralaterally (double-blind design). At 16 weeks after injection, patients were treated with 12 or 18 units of BTX-A bilaterally (open-label design). Trained observers and patients rated the wrinkles on a scale of 0 (none) to 3 (severe) at maximum contraction and repose and at baseline and 4-week intervals over a 16-week period after injection. RESULTS: All doses of BTX-A were significantly superior to placebo with no clear dose-response relationship. Benefits of the second injection lasted longer than the first. Few and mild adverse events were seen. CONCLUSION: BTX-A is a safe and effective treatment for crow's feet. Benefits are more sustained with repeat treatment.

Aged↗
PubMed2004

Fatal necrotic enteritis associated with Clostridium perfringens in wild crows (Corvus macrorhynchos).

Sporadic outbreaks of fatal enteritis occurred among free-living wild crows ('large billed' or 'wok' crow; Corvus macrorhynchos) in an open-air park in Japan in 2002. Eight crows were found dead during February, followed by two more in September, and five of the eight were examined histopathologically. At necropsy, all cases showed a markedly dilated small intestine, especially the jejunum and ileum, with large amounts of gas, and dark red to greenish-brown soft content. The necrotic intestinal wall was markedly thickened with multifocal haemorrhages. All cases had multifocal white foci in the liver, and four cases showed marked splenomegaly. Histologically, there was severe necrotic enteritis characterized by extensive mucosal necrosis and multifocal haemorrhages, as well as inflammatory cell infiltrations. A prominent pseudo-membrane formation was noted in the affected intestine. Severe adhesive peritonitis was also observed in three cases. Gram-positive bacilli were present in large numbers in the lumen, and in and around necrotic lesions in the affected intestine. The bacilli were positive for Clostridium perfringens enterotoxin type A by immunohistochemistry, and were also positive for C. perfringens type A using the immunofluorescence method. C. perfringens was isolated by anaerobic culture from the intestinal contents. The present enteritis was thought to be induced by proliferated C. perfringens in the intestine, and to be the cause of death.

Animals↗
PubMed2004

The crafting of hook tools by wild New Caledonian crows.

The 'crafting' of tools involves (i) selection of appropriate raw material, (ii) preparatory trimming and (iii) fine, three-dimensional sculpting. Its evolution is technologically important because it allows the open-ended development of tools. New Caledonian crows manufacture an impressive range of stick and leaf tools. We previously reported that their toolkit included hooked implements made from leafy twigs, although their manufacture had never been closely observed. We describe the manufacture of 10 hooked-twig tools by an adult crow and its dependent juvenile. To make all 10 tools, the crows carried out a relatively invariant three-step sequence of complex manipulations that involved (i) the selection of raw material, (ii) trimming and (iii) a lengthy sculpting of the hook. Hooked-twig manufacture contrasts with the lack of sculpting in the making of wooden tools by other non-humans such as chimpanzees and woodpecker finches. This fine, three-stage crafting process removes another alleged difference between humans and other animals.

Animals↗
PubMed2000

Human-like, population-level specialization in the manufacture of pandanus tools by New Caledonian crows Corvus moneduloides.

The main way of gaining insight into the behaviour and neurological faculties of our early ancestors is to study artefactual evidence for the making and use of tools, but this places severe constraints on what knowledge can be obtained. New Caledonian crows, however, offer a potential analogous model system for learning about these difficult-to-establish aspects of prehistoric humans. I found new evidence of human-like specialization in crows' manufacture of hook tools from pandanus leaves: functional lateralization or 'handedness' and the shaping of these tools to a rule system. These population-level features are unprecedented in the tool behaviour of free-living non-humans and provide the first demonstration that a population bias for handedness in tool-making and the shaping of tools to rule systems are not concomitant with symbolic thought and language. It is unknown how crows obtain their tool behaviour. Nevertheless, at the least they can be studied in order to learn about the neuropsychology associated with early specialized and/or advanced population features in tool-making such as hook use, handedness and the shaping of tools to rule systems.

Animals↗
PubMed2002

History, environment and social behaviour: experimentally induced cooperative breeding in the carrion crow.

Kin-based cooperative breeding, where grown offspring delay natal dispersal and help their parents to rear new young, has a long history in some avian lineages. Family formation and helping behaviour in extant populations may therefore simply represent the retention of ancestral features, tolerated under current conditions, rather than a current adaptive process driven by environmental factors. Separating these two possibilities challenges evolutionary biologists because of the tight coupling that normally exists between phylogeny and the environmental distribution of species and populations. The carrion crow Corvus corone corone, which exhibits extreme interpopulational variation in the extent of cooperative breeding, with populations showing no delayed dispersal and helping at all, provides a unique opportunity for an experimental approach. Here we show that offspring of non-cooperative carrion crows from Switzerland will remain on the natal territory and express helping behaviour when raised in a cooperative population in Spain. When we transferred carrion crow eggs from Switzerland to Spain, five out of six transplanted juveniles delayed dispersal, and two of those became helpers in the following breeding season. Our results provide compelling experimental evidence of the causal relationship between current environmental conditions and expression of cooperative behaviour.

Animals↗
PubMed1978

Species-typical and individually distinctive acoustic features of crow calls of red jungle fowl.

Crow calls of red jungle fowl (Gallus gallus) were analyzed for the purposes of (a) determining the extent of commonality and variability of acoustic features within and between individual roosters, and (b) characterizing the modal crow call of this species. Comparisons were made between crow calls of jungle fowl and those of domestic fowl to assess the extent to which domestication has affected these motor patterns.

Animals↗
PubMed2003

[Isolation and serotypes of Vero toxin-producing Escherichia coli (VTEC) from pigeons and crows].

To clarify the source and route of infection with Vero toxin-producing Escherichia coli (VTEC) in humans, we sampled gastrointestinal contents and isolated VTEC from wild birds captured to exterminate harmful birds between August 1997 and January 1998. Pigeons were caught in Sagamihara-shi and crows were caught in Sagamihara-shi, Kawasaki-shi, Yokohama-shi, and the Tokyo metropolitan area. The following results were obtained. 1) VTEC was isolated from 32 of 521 birds (6.1%) examined. Among pigeons, VTEC was isolated from 25 of 262 birds (9.5%) captured in Sagamihara-shi. Among crows, VTEC was isolated from 7 of 184 birds (3.8%) captured in Sagamihara-shi, but not isolated from any bird of 11.4, and 60 birds captured in Yokohama-shi, Kawasaki-shi, and the Tokyo metropolitan area, respectively. 2) Toxin was typed in 33 isolates. There were four VT1-producing isolates (6.5%), 27 VT2-producing isolates (88.7%), and two VT1, VT2-producing isolates (4.8%). 3) The serotypes of the isolates were: O78: H-, 10; O152: H-, 7; O153: H19.2; O164: H-, 1; O128: H-, 1; O164/143: H-, and O1: HUT, 1. The serotype was unknown in 10 isolates. Among 10 isolates for which the serotype could not be determined, auto-aggregation was observed in one isolate. 4) EaeA was investigated in the 33 isolates, and 31 isolates (93.9%) possessed eaeA. The above findings showed that strains with same toxin types and serotypes of human diarrhea-derived VTEC were isolated from pigeons and crows, and the isolates frequently possessed eaeA, which is considered to have an important association with its pathology, suggesting that birds are involved in VTEC infection in humans as a source of infection.

Animals↗
PubMed1981

Epizootology of Newcastle disease in Indian house crows.

During an investigation into the role of Indian house crows (Corvus splendens splendens) in the epizootology of Newcastle disease, a total of 164 samples from 82 crows were examined. Fifteen isolations of Newcastle diseases virus were made from 10 birds and one of these was highly pathogenic to chicken. Haemagglutination inhibition (HI) tests showed that 38 per cent of these crows possessed antibody to Newcastle disease virus. Initiation and duration of virus excretion and development of HI antibodies were also studied by experimental infection. Virus excretion began on day 3, continued till day 5 and complete elimination occurred by day 6. HI antibody titre began to rise from the seventh day to peak by the twenty-first day and declined thereafter.

Animals↗
PubMed1981

Pulmonary complications of tonsillectomy as originally described by Samuel J. Crowe, M.D.

The incidence of pulmonary complications of tonsillectomy is very low today in comparison to the early part of the 20th Century. Much of the credit belongs to Samuel Crowe and his colleagues who demonstrated that pulmonary complications could be prevented by the use of improved instrumentation and techniques which were based upon sound scientific principles. A historical review of anesthesia and the mouth gags of the early 1900's is included with a brief history of the development of the Crowe-Davis mouth gag. A review of the recent literature reveals few published papers about pulmonary complications. Those that are available show incidence figures similar to those of Dr. Crowe.

Anesthesia↗
PubMed2004

Experimental West Nile virus infection in blue jays (Cyanocitta cristata) and crows (Corvus brachyrhynchos).

Ten crows (Corvus brachyrhynchos) and three blue jays (Cyanocitta cristata), species indigenous to North America, were intravenously inoculated with 10(3) PFU of West Nile virus (WNV) strain NY99 for production of positive tissues for Canadian surveillance. Both species developed clinical signs 4 days postinoculation (dpi). Virus was detected in blood, cloacal and tracheal swabs, and in a number of organs by reverse transcriptase-polymerase chain reaction (RT-PCR) and virus isolation (titers reaching over 10(7) PFU/0.1 g). Virus appeared as early as 1 dpi in blood (10(2)-10(3) PFU/ml) and spleen (10(3)-10(4) PFU/0.1 g of tissue), whereas kidney, liver, intestine, gonads, heart, skeletal muscle, and lung tested positive for WNV in a later stage of the infection. Immunostaining (IHC) using heterologous rabbit anti-WNV polyclonal antiserum detected viral antigen in a wide range of organs, starting at 2 dpi. Detection of WNV antigen in the brain of blue jays and crows by IHC was laborious as only few cells, not present in all sections, would stain positive. Mononuclear cells appeared to be an important target for virus replication, contributing to virus spread throughout tissues during the infection. This conclusion was based on the positive IHC staining of these cells in organs before virus antigen detection in parenchymal cells and supported by virus isolation and RT-PCR-positive results in white blood cells. The inability of blue jays and crows to perch and fly may reflect weakness due to generalized infection and marked skeletal muscle involvement, although involvement of the central nervous system cannot be excluded.

Animals↗
PubMed1984

Relative potencies of testosterone and 5 alpha-dihydrotestosterone on crowing and cloacal gland growth in the Japanese quail (Coturnix coturnix japonica).

It has been suggested that testosterone is less effective at inducing crowing behaviour in young birds than in adults because of the presence of higher levels of steroid 5 beta-reductase in the young brain, which converts testosterone to inactive 5 beta-reduced metabolites. This hypothesis was tested indirectly by comparing the relative potencies of 5 alpha-dihydrotestosterone (5 alpha-DHT), which cannot be converted to 5 beta-metabolites, and testosterone at inducing crowing in young gonadectomized male and female quail. The promotion of cloacal gland growth by these treatments was also assessed since there are no age-related changes in 5 beta-reductase in this organ. Silicone elastomer implants (2 X 5, 5 and 10 mm) containing 5 alpha-DHT were more effective at stimulating crowing than similar implants of testosterone whilst there was little difference in their potency at inducing cloacal gland growth. These results are consistent with the hypothesis that brain steroid 5 beta-reductase regulates the behavioural activity of testosterone in the brain of young birds.

Animals↗
PubMed2000

VEGF is causative for pulmonary hypertension in a patient with Crow-Fukase (POEMS) syndrome.

We report a case of Crow-Fukase (POEMS) syndrome associated with pulmonary hypertension (PH). In this case, the concentration of vascular endothelial growth factor (VEGF) was extremely high in the serum, and the levels of IL-1beta, IL-6, TNF-alpha, and thiamine, which were thought in past reports to be mediators of PH in Crow-Fukase syndrome, were normal. After prednisolone therapy, PH disappeared with a dramatic decrease in serum VEGF. Our results suggest that VEGF is closely correlated with PH in Crow-Fukase syndrome.

Cytokines↗
PubMedDate not supplied

Crow deaths as a sentinel surveillance system for West Nile virus in the northeastern United States, 1999.

In addition to human encephalitis and meningitis cases, the West Nile (WN) virus outbreak in the summer and fall of 1999 in New York State resulted in bird deaths in New York, New Jersey, and Connecticut. From August to December 1999, 295 dead birds were laboratory-confirmed with WN virus infection; 262 (89%) were American Crows (Corvus brachyrhynchos). The New York State Department of Health received reports of 17,339 dead birds, including 5,697 (33%) crows; in Connecticut 1,040 dead crows were reported. Bird deaths were critical in identifying WN virus as the cause of the human outbreak and defining its geographic and temporal limits. If established before a WN virus outbreak, a surveillance system based on bird deaths may provide a sensitive method of detecting WN virus.

Animals↗