SEARCH · Search PubMed

Results for “Reproductive Isolation”

Search indexed PubMed citations on genomics, clinical trials, systematic reviews and public health. Explore titles, authors and supplied subject terms, then open the PubMed record.

SourceResearch connectionFrom yearThrough year

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 667 records · Page 37Linked to original sources

PubMed1983

Isozymic differentiation of two sibling species of Squatina (chondrichthyes) in South Brazil.

Two sympatric morphotypes of the nominal species Squatina argentina from South Brazil are compared by the frequencies of 25 isozymes distributed over 14 presumptive loci. The Nei's Genetic Identity index obtained in a comparison of the populations is of 0.71. The loci EST-2 and EST-4 are fixed at different isozymes for each population, indicating a reproductive isolation between them. The most significant morphological and meristical differences between the morphotypes are the presence or absence of dorsal spines and the dental formula. The agreement between these characteristics and the genetical data indicates that the two morphotypes belong to different species.

Animals↗

PubMed1985

A threshold model for punctuated gradualism.

A model for continuous and discontinuous evolutionary change is proposed that accommodates both punctuated equilibrium and phyletic gradualism. Natural selection operating on a gaussian distribution of phenotypes subjected to severe stress will result in a skewing of the normal distribution in the direction of the favoured phenotype. If a reproductive isolation threshold is imposed upon this model, rapid crossing of the threshold by large numbers of individuals within the skewed distribution will result in the sudden achievement of a critical descendant population mass. Mild directional selection however, will result in gentle shifts of the gaussian mean thus leading us to suggest that stasis and incipient speciatior are extremes of the same spectrum, defined by the rates of mean-shift in response to varying severities of selection pressure. Both punctuated and gradualistic evolution as accommodated in our model may further be described within Thom's cusp catastrophe theory.

Biological Evolution↗

PubMed1993

Radiation of chromosome shuffles.

Rock wallabies, Petrogale, exhibit chromosome diversity that is exceptional in marsupials, with 20 distinct chromosome races being recognized. Many of the karyotypic changes identified within Petrogale appear to be recent, although the rate of chromosome evolution varies between taxa. While the patchy distribution of Petrogale and their social structure would facilitate the fixation of novel rearrangements, these factors alone do not explain the pattern of chromosome evolution shown in this group. The chromosome changes that have come to characterize each taxon may offer selective advantages in the particular areas occupied, or it may be that these rearrangements play an important role in reproductive isolation. In Petrogale, the taxa with the largest number of chromosome rearrangements are those that are sympatric, or have multiple zones of parapatry, with other members of the genus. Male hybrids from a variety of chromosomal admixtures were found to be sterile, but with those heterozygous for the least complex rearrangements being least affected. As expected, equivalent female hybrids were less severely affected. Chromosomal and genic changes both appear important in these processes.

Animals↗

PubMed2004

Interspecific and intraspecific variations in sibling species of sea urchin Echinometra.

Interspecific and intraspecific morphological and fertilization variations were studied in three sibling species of Echinometra (known as sp. B, C and D) found off the coast of Okinawa, Japan. Eggs from C and D were readily fertilized by sperm from all three color morphs of B when the sperm concentrations were high, but no fertilization was observed when sperm of the former were mixed with eggs from the latter. Under limiting sperm concentrations, however, both C and D were incapable to fertilize reciprocally with B. In contrast, crossing between C and D produced fertilization membrane at high and limiting sperm concentrations in both directions. Interspecific crosses between B vs. C and B vs. D clearly showed that these combinations were reproductively isolated in contrast to that observed for crossing between C and D. Interestingly, intraspecific fertilization of B showed considerable morphological variation in addition to variability in fertilization success. Intraspecific fertilization and morphological variations may occur due to a number of genetic and/or non-genetic factors. While the underlying cause(s) remain to be elucidated, the results of the present study suggest that B is now speciating very slowly.

Animals↗

PubMed2006

Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis.

The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally alpha-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH2) lacks the cyclic heptapeptide domain Cys18-(Xaa)4-Lys-Cys24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations< or =25 microM) and relatively low hemolytic activity against human erythrocytes (LD50=100 microM). The peptide therefore represents a candidate for drug development.

Amino Acid Sequence↗

PubMed2006

Origin and colonization history of newly virulent strains of the phytopathogenic fungus Venturia inaequalis.

Plant resistance based on a gene-for-gene relationship tends not to be durable because virulent strains can emerge through mutation and colonize formerly resistant cultivars over large areas. Our objective was to determine the origin and colonization history of newly virulent strains of the fungus Venturia inaequalis. Four hundred and eighty-one strains from seven multi-cultivar orchards within a 300km wide area were collected from a cultivar carrying the overcome Vf-gene (Vfcv populations) and from non-Vf cultivars (nVfcv populations). Using 9 microsatellite loci, we showed that Vfcv populations were closely related though highly differentiated, indicating they have been recently founded following rare long distance dispersal events from a common origin. Assignment tests revealed that the Vfcv populations had not emerged from any of the nVfcv populations. Vfcv populations had a low diversity and were strongly differentiated from nVfcv populations several years after the first reported breakdown, suggesting reproductive isolation between the two populations.

Ascomycota↗

PubMed2005

Latent structure of dermatoglyphs in the population of Selska Valley.

The historical records of Selska Valley reveal that the eastern part of this area was first settled by Slovene agrarian colonists, the western part by German colonists and the central part by Friulians. These were later followed by Slovene and Slovenized settlers, who penetrated the valley from north to south. Because of its reproductive isolation, the population of Selska Valley is highly suitable for the study of population structures. The quantitative traits of the digital and palmar dermatoglyphs are polygenetically determined characteristics, which, due to their selective inertness to changes, may provide an insight into microevolutionary processes. The purpose of our study was to identify the possible differences between the populations of villages in the valley and the mountain villages attributable to various migration flows through history. Altogether 340 finger and palm prints of 163 males and 177 females were collected in two groups of villages: (1) the lowland villages (Praprotno, Bukovica, Sevlje, Dolenja vas, Selca, Zelezniki and Zali log), and (2) the mountain villages (Podlonk, Prtovc, Spodnje Danje, Zgornja Sorica and Spodnja Sorica). The 18 dermatoglyphic variables were analyzed. A statistical analysis using standard methods was performed and the latent structure evaluated using factor analysis. The discriminant analysis and latent structure of the quantitative properties of dermatoglyphs suggest the presence of certain differences in gene pools of two studied populations (the group of villages in the valley and the group of mountain villages). It is highly probable that these differences can be attributed to low migration in the Selska Valley and to the 'selective inertness' of quantitative dermatoglyphic traits. In a previous study, no significant biological differences between the studied populations were found in qualitative dermatoglyphic traits. This indicates that Selska Valley and its village populations represent a specific isolate, and therefore expanded studies of this type could significantly contribute to a better understanding of the population concerned and isolates in general.

Analysis of Variance↗

PubMed2004

Chromosomal speciation: a reply.

The "genic" and the "non-genic" (chromosomal) hypotheses for the predominant mechanism by which species diverge into two have long been in contention. In 1998 Coyne and Orr attacked certain formulations of the chromosomal hypothesis on the grounds that they required macromutations (structural changes in chromosomes). In 1999 I replied that numerous independent micromutations (single DNA base changes) should suffice (GC% hypothesis). Kliman et al., with the support of Coyne and Charlesworth, have presented various counterarguments, to which the present paper responds with evidence that GC% differences are primary to genic differences and would operate by changing the structure of stem-loops extruded from duplex DNAs. Chromosomes attempting to align by means of complementary loop-loop interactions would fail if GC% differences exceeded a critical threshold. This would disrupt meiosis (hybrid sterility) and the parents of organisms with failed meiosis would be reproductively isolated from each other. If they could find new mates with which they were GC-compatible, then new species could emerge. The model leads to predictions consistent with several lines of evidence. The GC% version of the chromosomal hypothesis has a sound basis and deserves at least as much attention as its genic rival.

Animals↗

PubMed2005

Morphometrical evidence for speciation within Bolivian Lutzomyia aragaoi (Diptera: Psychodidae).

For Bolivian specimens of Lutzomyia aragaoi (Costa Lima, A., 1932. Sobre os phlebotomos americanos (Diptera, Psychodidae). Mem. Inst. Oswaldo Cruz 26, 15-69), collected in the same light-traps, we show the existence of two distinct morphotypes distinguished by male parameres. These sympatric forms were observed in the Alto Beni, Subandean region of Bolivia, and in the North Beni, Amazonian region of Bolivia, two areas separated by large, sparsely forested, "llanos". Univariate morphometric comparisons between these two forms showed non-overlapping variation of size for external structures of the genitalia (lateral lobe, style and coxite), allowing separation of them on the basis of a single measurement. Multivariate discriminant analysis of head and wing dimensions-excluding genitalia structures-grouped the insects according to their morphotype instead of their geographic origins. The two forms also showed different patterns in number and distribution of low mesepisternal setae. The existence of these two separate forms in close sympatry suggests reproductive isolation, hence a speciation process.

Animals↗

PubMed2005

Sympathetic and T helper (Th)2 bias may ameliorate uterine fibroids, independent of sex steroids.

We propose that inadequate sympathetic bias and Th2 bias in the uterine environment contributes to the formation of fibroids, independent of the sex steroid status. We also propose that fibroids represent a modern maladaptation that partly results from decreasing exposure to seminal fluid, which contains catecholalmines, transforming growth factor beta1 (TGFbeta1), aldosterone, prostaglandins, and other factors that shift the uterine environment to sympathetic and T helper (Th)2 bias. Lower risk of fibroids is associated with pre-menarche, post-menopause, pregnancy, exposure to contraceptives, smoking, earlier age of first pregnancy, shorter interval since last pregnancy, higher parity, and non-obesity. These associations are currently attributed to alterations of sex steroids. However, the association may also be explained by the observation that pre-menarche, post-menopause, pregnancy, and smoking represent periods of sympathetic and Th2 bias. Furthermore, use of contraceptives, early age of first pregnancy, short interval since last pregnancy, high parity, abnormal pap smear, and non-obesity may represent surrogates for increased sexual activity and increased exposure to seminal fluid. Catecholalmines, aldosterone, TGF, and prostaglandins are among the seminal fluid components that promote sympathetic and Th2 bias. Vasectomized copulations protect against fibroids, an observation that undermines the steroid hypothesis and supports our hypothesis. The putative mechanism of action of uterine artery embolization (UAE) for fibroid treatment is starvation of blood supply, but the extensive collaterals that protect uterine perfusion would presumably also buffer against fibroid hypoperfusion. Instead, the sympathetic and Th2 responses to UAE-related ischemia may contribute to fibroid regression. A potential explanation for the association of fibroids with intrauterine devices may be a Th1 cell-mediated immune response to the foreign body, which may also enhance the contraceptive effect. Novel methods of preventing and treating fibroids by promoting sympathetic and Th2 shift through natural, pharmacologic, and neuromodulatory means are envisioned. Fibroids are likely a modern dysfunction given the high Darwinian fitness cost of fibroid-related infertility, and may be attributable to reduced intercourse frequency. Fibroids have been observed among animals in captivity that are presumably reproductively isolated.

Female↗

PubMed2006

Evaluating genetic containment strategies for transgenic plants.

One of the primary concerns about genetically engineered crop plants is that they will hybridize with wild relatives, permitting the transgene to escape into the environment. The likelihood that a transgene will spread in the environment depends on its potential fitness impact. The fitness conferred by various transgenes to crop and/or wild-type hybrids has been evaluated in several species. Different strategies have been developed for reducing the probability and impact of gene flow, including physical separation from wild relatives and genetic engineering. Mathematical models and empirical experimental evidence suggest that genetic approaches have the potential to effectively prevent transgenes from incorporating into wild relatives and becoming established in wild populations that are not reproductively isolated from genetically engineered crops.

Chimera↗

PubMed2005

Chromosome evolution in eukaryotes: a multi-kingdom perspective.

In eukaryotes, chromosomal rearrangements, such as inversions, translocations and duplications, are common and range from part of a gene to hundreds of genes. Lineage-specific patterns are also seen: translocations are rare in dipteran flies, and angiosperm genomes seem prone to polyploidization. In most eukaryotes, there is a strong association between rearrangement breakpoints and repeat sequences. Current data suggest that some repeats promoted rearrangements via non-allelic homologous recombination, for others the association might not be causal but reflects the instability of particular genomic regions. Rearrangement polymorphisms in eukaryotes are correlated with phenotypic differences, so are thought to confer varying fitness in different habitats. Some seem to be under positive selection because they either trap favorable allele combinations together or alter the expression of nearby genes. There is little evidence that chromosomal rearrangements cause speciation, but they probably intensify reproductive isolation between species that have formed by another route.

Animals↗

PubMed2005

Orchid diversity: an evolutionary consequence of deception?

The Orchidaceae are one of the most species-rich plant families and their floral diversity and pollination biology have long intrigued evolutionary biologists. About one-third of the estimated 18,500 species are thought to be pollinated by deceit. To date, the focus has been on how such pollination evolved, how the different types of deception work, and how it is maintained, but little progress has been made in understanding its evolutionary consequences. To address this issue, we discuss here how deception affects orchid mating systems, the evolution of reproductive isolation, speciation processes and neutral genetic divergence among species. We argue that pollination by deceit is one of the keys to orchid floral and species diversity. A better understanding of its evolutionary consequences could help evolutionary biologists to unravel the reasons for the evolutionary success of orchids.

Journal Article↗

PubMed2026

De novo Genes in Plants: Origins, Mechanisms, and Functional Implications.

De novo genes originate from previously non-coding genomic regions. They provide an important source of lineage-specific innovation. In plants, these genes may contribute to adaptation, trait diversity and crop evolution. This review summarizes recent progress in plant de novo gene research. It first discusses major routes of gene birth, including transcription-first, open reading frame (ORF)-first and concurrent models. It also examines how nascent loci acquire regulatory control and enter existing biological networks. The review then summarizes their evolutionary features, including weak early constraint, rapid molecular change, restricted expression and structural refinement. It further discusses plant de novo genes involved in stress responses, seed germination, kernel dehydration, subspecies divergence, reproductive isolation and floral scent diversification. Current methods for identifying de novo genes remain limited by rapid sequence evolution, genome annotation quality, polyploidy and transposable elements. Whole-genome synteny alignment, multi-omics evidence and machine-learning approaches can improve candidate discovery. However, each method has important limitations. Finally, this review highlights key future questions in functional validation, latent coding potential in long non-coding RNAs, epigenetic activation, regulatory-network integration and crop improvement. These perspectives clarify how de novo genes shape plant adaptation and how they may be used in precision breeding and synthetic biology.

adaptive evolution↗

PubMed2005

Electrophysiological and molecular genetic evidence for sympatrically occuring cryptic species in African weakly electric fishes (Teleostei: Mormyridae: Campylomormyrus).

For two sympatric species of African weakly electric fish, Campylomormyrus tamandua and Campylomormyrus numenius, we monitored ontogenetic differentiation in electric organ discharge (EOD) and established a molecular phylogeny, based on 2222bp from cytochrome b, the S7 ribosomal protein gene, and four flanking regions of unlinked microsatellite loci. In C. tamandua, there is one common EOD type, regardless of age and sex, whereas in C. numenius we were able to identify three different male adult EOD waveform types, which emerged from a single common EOD observed in juveniles. Two of these EOD types formed well supported clades in our phylogenetic analysis. In an independent line of evidence, we were able to affirm the classification into three groups by microsatellite data. The correct assignment and the high pairwise F(ST) values support our hypothesis that these groups are reproductively isolated. We propose that in C. numenius there are cryptic species, hidden behind similar and, at least as juveniles, identical morphs.

Africa↗

PubMed2006

Molecular phylogeny of Banza (Orthoptera: Tettigoniidae), the endemic katydids of the Hawaiian Archipelago.

The extant endemic katydids (Orthoptera: Tettigoniidae) of the Hawaiian Archipelago include one to three species per high island and a single species on Nihoa, all currently placed in the genus Banza. These acoustic insects provide an excellent opportunity for investigating the evolution of reproductive isolation and speciation, but such studies require an understanding of phylogenetic relationships within the group. We use maximum parsimony, likelihood-based Bayesian inference, and maximum likelihood to infer phylogenetic relationships among these taxa, based on approximately 2kb of mitochondrial cytochrome oxidase I and cytochrome b. Our results strongly support two distinct high island clades: one clade ("Clade I") composed of species from Kauai, Oahu, Molokai, and Lanai and another clade ("Clade II") composed of species from Maui and Hawaii (Banza unica, from Oahu, may be basal to both these clades, but its placement is not well resolved). Within these clades, some inferred relationships are strongly supported, such as the sister status of B. kauaiensis (Kauai) and B. parvula (Oahu) within Clade I, but other relationships remain more ambiguous, such as the relative position of B. brunnea (Maui) within Clade II. Although a detailed reconstruction of the historical biogeography of the Hawaiian katydids is difficult, we use our genetic data combined with the known geological history of the Hawaiian Islands to set limits on plausible historical scenarios for diversification of this group. Beyond these historical biogeographic inferences, our results indicate possible cryptic speciation on both Oahu and Hawaii, as well as what may be unusually high average rates of nucleotide substitution. The present work sets the stage for future genetic and experimental investigations of this group.

Animals↗

PubMed2006

Genetic differentiation and cryptic speciation in natural populations of Drosophila lacertosa.

Drosophila lacertosa, an Oriental member of the robusta species group in the virilis-repleta radiation, has a wide distribution from northern India throughout China to the Far East. Phylogenetic analyses of mitochondrial ND2 gene sequences revealed two genetically significantly diverged lineages with 2.1% DNA sequence divergence. These two lineages are largely allopatric: one is mainly found in southwest China (lineage A), whereas the other ranges central and east of China to northeast Asia (lineage B). The geographic distributions of these two clades narrowly overlap near the provincial boundaries of Yunnan and Guizhou or Guangxi, probably as a consequence of population expansion and secondary contact. These two lineages were estimated to have diverged about 0.56 Mya, and the estimated time of expansion was approximately 70,000 years ago for lineage A population, and 110,000 years ago for lineage B population. The present molecular analysis, together with nearly complete reproductive isolation between those two lineages, strongly suggests that the two lineages might be incipient species.

Animals↗

PubMed2000

Molecular and morphologic approaches to discrimination of variability patterns in chub mackerel, Scomber japonicus.

The systematic status and the evolutionary biology of chub mackerel (Scomber japonicus) in the South West Atlantic Ocean is confusing with an unknown degree of genetic differentiation and reproductive isolation between units. Simultaneous genetic and morphologic analyses were made on 227 fish collected from two areas of the South West Atlantic Ocean and one from the Mediterranean Sea. The genetic analysis was based on 36 protein-coding loci, 16 of which were variable. The morphologic analyses include six morphometric length measurements and a meristic character. Correspondence between genetic and morphologic variability patterns indicates isolated Mediterranean and Southwest Atlantic subgroups of S. japonicus and, less clearly, possible additional divergence in two regional stocks within the latter group. The most conservative approach to management is to manage the stocks independently of one another.

Journal Article↗