Use of iodide salts in the isolation of antibodies and the dissolution of specific immune precipitates.
Explore the source record for details and available documents.
Biomedical subjects
Publications and source records attributed to T Ternynck.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
Hybridomas from lymph node cells of a mouse C57BL/6 immunized with peroxidase were prepared. Two hybridoma proteins, one with and one without reactivity towards peroxidase, were selected and used to prepare antiidiotypic antisera in rabbits. The idiotypic cross-reactions between these two hybridoma proteins were studied using these antiidiotypic antisera. The results obtained indicate that at least two main idiotopes are present on the non-peroxidase binding hybridoma protein, only one of which is shared by the peroxidase-binding hybridoma protein.
We recently reported that translocating murine polyreactive anti-DNA antibodies can be used as vectors for the transfer of macromolecules into cells growing in culture. We show here that two such monoclonal antibodies (J20.8 and F4.1) conjugated to polylysine with a high (93) but not a low (19) number of lysine residues can transfer genes in the presence of serum. A 30 amino acid long peptide, VAYISRGGVSTYYSDTVKGRFTRQKYNKRA (peptide P3), corresponding to joined heavy-chain complementary-determining regions 2 and 3 of F4.1 antibody and carrying 19 lysine residues at its N-terminal, was found to be an efficient vector for the transfection of the luciferase gene into 3T3 and CCL39 cells in the presence of serum. Addition of 0.23 M glycerol during transfection considerably enhanced gene delivery. These results show that conjugation of a short polylysine tail converted a spontaneously internalizing peptide into a potent nontoxic plasmid vector.
Mice were given increasing doses of sheep serum albumin emulsified with Freund's complete adjuvant in hind footpads. The kinetics of development of cells which synthesize antibody or immunoglobulins without antibody function was studied in the draining lymph nodes. Results show the relationship between the two cell populations: as the number of antibody synthesizing cells increased, the number of immunoglobulin synthesizing cell increased, and conversely. Between 0.050 and 2.5 mg of antigen, the number of cells of each population increased with the dose injected whereas with 5 and 10 mg, this number is smaller than that obtained with smaller doses and decreased with an increasing dose.
Surface Ig and theta-antigen of lymphocytes collected on the bottom of Beem capsules were stained by an indirect immunoperoxidase technique to compare B and T cells at the ultrastructural level. To distinguish the two markers, the surface Ig was allowed to cap during the incubation with anti-Ig antiserum while the incubation with anti-theta alloantiserum was performed at 4 degrees to obtain a staining in a ring pattern. This method was applied to the study of lymphocytes from spleen, lymph nodes and thymus of normal mice. Lymphocytes forming rosettes with SRBC were also studied at different days after immunization with SRBC.
A system for characterization of lymphoplasma cells based on ultrastructural, immunocytological and autoradiographic data is proposed. It is composed of six cell types and transitional forms. Any mouse lymphocyte can be classified within one of these forms and the lymphocytes of a lymphoid organ may be subdivided into populations of characteristic cells. The cell types are defined as follows: 1) the differentiated Ig lymphocytes which bear Ig at their surface, have a rough nuclear sap, a granular cytoplasm and often show mcrovilli at the cell surface; none of these lymphocytes incorporate thymidine and therefore this subpopulation can be considered as mature; 2) the differentiated plasmacytes have a well organized rough endoplasmic reticulum; differentiated plasmacytes are not 3H-thymidine labelled and this subpopulation is mature; 3) the differentiated T lymphocytes with theta-antigen at their cell surface contain a smooth endoplasmic reticulum, a developed Golgi apparatus and lysophagosomes; the differentiated T lymphocytes show no 3H-thymidine labelling and this subpopulation is also mature; 4) in the large lymphocytes without surface Ig nor theta-antigen, chromatin aggregate are intermingled to the nuclear sap and a large nucleolus is present; this subpopulation of lymphocytes, a number of which show usually 3H-thymidine labelling, is immature; 5) the small lymphocytes without surface Ig nor theta-antigen have a large nuclear cytoplasm ratio; like the large lymphocytes, this population is also immature, since a percentage of these cells usually incorporates thymidine; 6) small T lymphocytes are labelled by the theta-antigen marker; after antigenic stimulation some of them are found to incorporate thymidine. Transitional forms between two cell types are also observed. They are more numerous immunization. This system of cell characterization is an attempt to correlate structure with function of lymphocytes withing the T and B cell concept of experimental immunology.
After primary immunization of mice, rats and rabbits with antigens (horse radish peroxidase, bovine serum albumin and muchroom tyrosinase) emulsified in complete or incomplete Freund's adjuvant, both cells synthesizing immunoglobulin without detectable antibody function and antibody-producing cells were detected. The first cells which appeared were synthesizing and secreting IgG and IgM immunoglobulins without antibody function. These cells were progressively replaced by cells synthesizing and secreting antibodies. In some plasma cells of mice, rats and rabbits immunized with peroxidase, antibody activity was detected only in restricted areas of the cytoplasm ; the remainder contained antigenic determinants of immunoglobulins. After secondary immunization the results were the following: in mice, both cells containing immunoglobulins without antibody function and antibody-containing cells appeared simultaneously and they were present in equal amount; in rats, only the antibody-containing cells were present in high number. Immunizations performed using different protein antigens (horse radish peroxidase, human and bovine serum albumin, aggregated and desaggregated human IgG, and ovalbumin) injected as a solution in saline have shown that after antigenic stimulation both populations of cells appeared, their number depending on the dose of the antigen injected. Further experiments carried out with tolerant mice, with germ-free animals and with "B" mice have shown that the appearance or not of antibody-producing cells was always related with respectively the presence or absence of cells synthesizing immunoglobulins without detectable antibody function. Finally experiments performed on rabbits have shown that some cells containing immunoglobulins without antibody function share idiotypic determinants in common with cells synthesizing antibodies.
An immunoenzymatic procedure has been developed based on the use of monoclonal antibodies specific for 5-bromodeoxyuridine (BdUr). It allows the detection of BdUr-labelled DNA immobilized on a nitrocellulose filter. Using this procedure, it was possible to detect up to 0.5 pg of mammalian DNA labelled in vivo with BdUr, 5 pg of nick-translated BdUr-labelled PBR-322 and, using this latter probe and dot-blot hybridization, 50 pg of native unlabelled PBR-322.
A method using p-benzoquinone for coupling antigens and antibodies to enzymes and erythrocytes is described. The method involves the treatment of proteins (or polysaccharides) at pH 6 or 7 with an excess of p-benzoquinone. After removal of the unreacted reagent by gel filtration, the "activated" proteins were coupled at pH 8-9 with enzymes or erythrocytes. Biological activities of the proteins were not substantially modified by this treatment since 80-100% of the antigen binding capacity was found to be preserved in p-benzoquinone treated antibodies or Fab fragments. Anti-Ig antibodies (or Fab) were coupled by this procedure to peroxidase, alkaline phosphatase, lactoperoxidase, glucose oxidase and beta-galactosidase, and the conjugates obtained were found to be highly effective in detecting intracellular Ig by immunohistochemical techniques. Erythrocytes coated with sheep anti-mouse Ig antibody or Fab were used to titrate by passive hemagglutination serum Ig. The same erythrocytes were employed to detect by plaque assay mouse Ig secreting cells. Erythrocytes coated with peroxidase, alkaline phosphatase, bovine serum albumin, ribonuclease, Salmonella polysaccharide (B 27 +) and pneumoccocal polysaccharide SIII were employed to titrate serum antibody by passive hemagglutination and hemolysis and to detect mouse antibody secreting cells by plaque assay. All the antigens and antibodies coated erythrocytes prepared gave highly satisfactory and reproducible results.