[Serine: pyruvate aminotransferase of rat liver--organelle localization and multihormonal regulation of its synthesis].
Explore the source record for details and available documents.
Biomedical subjects
Publications and source records attributed to T Oda.
Explore the source record for details and available documents.
Twenty-two cases of primary gastric lymphoma have been clinicopathologically reviewed and factors influences the prognosis were examined. An increased tumor size of more than 10 cm, an increased tumoral penetration, a lymph node involvement, and stage IV classification decreased the survival rates. All patients given stage I classification have remained alive without having received chemotherapy. The survivors of stages III & IV amounted to only three patients who were treated by surgery and systemic chemotherapy. A radical operation is the choice of treatment for a gastric lymphoma but aggressive chemotherapy should be supplemented for advanced cases.
We found and characterized a type D retrovirus produced in a human lymphoblastoid cell line of B-cell lineage. The amino acid sequence of the N-terminal region of the purified major structural protein (PVTRSQGQVSSNTTGRASPHPDTHTIPE) revealed no high homology with any of the known retroviral amino acid sequences. We have cloned cDNA and the proviral genome integrated in the retrovirus-producing cells, and determined the complete nucleotide sequence and gene structures of the genome. The provirus genome is 8785 bp long and has the structure of LTR-gag-prt-pol-eny-LTR. The nucleotide sequences of the long terminal repeat (LTR) region and a part of the pol gene were closely related to the available sequences of squirrel monkey retrovirus (SMRV), and we designated this virus SMRVHLB' abbreviated as SMRV-H. The primer (tRNA(Lys)1,2)-binding sequence of SMRV-H (TGGCGCCCAGGACGTGGGGCTCGA) has a GG insertion, which is different from that of SMRV. The transmembrane protein of the 3' terminal region of env gene contains an amino acid sequence of an immunosuppressive peptide (EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS), in which R is unique in SMRV-H. The core sequence of the glucocorticoid regulatory element is found upstream of the two 42-bp imperfect repeats in the LTR. Sequences partially homologous to those of the rat IgE-binding protein gene are in gag and pol genes.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
Explore the source record for details and available documents.
A 37-year-old male was admitted to our hospital because of an abdominal tumor, about the size of a fist, located anterior to the pancreas head. This tumor oppressed the antrum of the stomach to the left, and an operation was performed, the tumor being diagnosed as a leiomyosarcoma of the stomach, determined from image findings. After histopathological examination, however the tumor proved to be an adenocarcinoma. An early gastric cancer was found at the anterior wall of the antrum during the operation, and the tumor was thought to be a metastatic lymph node. Lymph node metastasis also was observed at the root of the mesentery.
Explore the source record for details and available documents.
Monoclonal antibodies against Thomsen-Friedenreich antigen (T-Ag) were obtained by the hybridoma technique. The expression of T-Ag in 73 specimens of bladder cancer was examined by the immunofluorescence method using these monoclonal antibodies. Seventeen (53%) of grade I, 18 (44%) of grade II and 5 (50%) of grade III were diffusely stained with anti-T. Of the T-negative tumors, 14 (44%) of grade I and 13 (32%) of grade II showed positive staining after neuraminidase treatment (cryptic T-positive) while only 1 (10%) of grade III was cryptic T-positive. On the contrary, only 1 case (3%) of grade I was cryptic T-negative while 10 (24%) of grade II and 4 (40%) of grade III (were. The T-antigen expression and the histological grades correlated significantly (p less than 0.05). Twenty-eight (70%) of the T-positive cases and 9 (60%) of the cryptic T-negative cases recurred while only 3 (11%) of the cryptic T-positive cases did (p less than 0.01). The monoclonal antibodies were more useful than peanut lectin (PNA) or conventional polyclonal antibodies on the detection of T-antigen.
Ceftriaxone (CTRX) was studied for its efficacy and safety in 8 cases of infection during the perinatal period; 6 before, and 2 after delivery. The results obtained are recognized as follows: 1. CTRX was administered by intravenous drip infusion at a daily dose between 2 and 4 g for 2 to 10 days (a total dose: 4 to 20 g) each of 8 cases of infections during the perinatal period; 3 of amniotic fluid infection and 1 each of intrauterine infection, puerperal fever, puerperal wound infection, appendicitis and pyelonephritis. CTRX was evaluated to be very effective in 3, effective in 3 and ineffective in 2, with an efficacy rate of 75% (6/8). 2. Two strains of Enterococcus faecalis and 1 each of Pseudomonas cepacia and Streptococcus intermedius were isolated. All of them were eradicated by the CTRX treatment bacteriologically. 3. No adverse reactions were observed subjectively or objectively. A slight transient elevation of GOT, GPT and Al-P was observed in 1 case. No abnormal sign was observed in neonates.
A case of a leiomyosarcoma of the duodenum is reported. A 52-year-old man with a duodenal submucosal tumor underwent a pancreatico-duodenectomy. Histologically, the resected tumor revealed moderate cellular atypism and moderate pleomorphism, but revealed no mitotic figures. The histological diagnosis was leiomyoma. Nine years after operation, the tumor showed a recurrence and metastasis in the liver. Thus, the patient underwent a lobectomy of the liver. The resected liver tumor showed similar histological features seen in the primary duodenal tumor but with high mitotic activity. Histologically, the patient was diagnosed as having a metastatic leiomyosarcoma. This history suggests that a smooth muscle tumor of potential malignancy, as seen in this case, should be followed continuously, even though mitoses may not be recognized.
Explore the source record for details and available documents.
The nucleotide sequence of the mRNA coding for the precursor of mitochondrial serine:pyruvate aminotransferase of rat liver was determined from those of cDNA clones. The mRNA comprises at least 1533 nucleotides, except the poly(A) tail, and encodes a polypeptide consisting of 414 amino acid residues with a molecular mass of 45,834 Da. Comparison of the N-terminal amino acid sequence of mitochondrial serine:pyruvate aminotransferase with the nucleotide sequence of the mRNA showed that the mature form of the mitochondrial enzyme consisted of 390 amino acid residues of 43,210 Da. The amino acid composition of mitochondrial serine:pyruvate aminotransferase deduced from the nucleotide sequence of the cDNA showed good agreement with the composition determined on acid hydrolysis of the purified protein. The extra 24 amino acid residues correspond to the N-terminal extension peptide (pre-sequence) that is indispensable for the specific import of the precursor protein into mitochondria. In the extension peptide there are four basic amino acids distributed among hydrophobic amino acids and, as revealed on helical wheel analysis, the putative alpha-helical structure of the peptide was amphiphilic in nature. The secondary structures of the mature serine:pyruvate aminotransferase and three other aminotransferases of rat liver were predicted from their amino acid sequences. Their secondary structures exhibited a common feature and so we propose the specific lysine residue which binds pyridoxal phosphate as the active site of serine:pyruvate aminotransferase.
Extracellular serratial protease (56,000 Da) is known to be cytotoxic. Fluorescein isothiocyanate-labeled protease was found to form a complex with human alpha 2-macroglobulin (alpha 2M), and this enzyme-inhibitor complex was purified. The protease was found to be internalized by fibroblasts in culture as a complex with alpha 2M, which resulted in cell destruction. Regeneration of enzyme activity was confirmed in cells after 2-3 h of incubation. Chicken egg-white ovomacroglobulin, a homolog of human alpha 2M, formed a complex with this enzyme similarly and more tightly but failed to exhibit protease activity, cytotoxicity, and internalization into cells.
The binding of a copoly(styrene-maleic acid)-conjugated neocarzinostatin (NCS) designated as smancs (Mr 16,000), and parental NCS (Mr 12,000) to cultured cells was investigated. These drugs were labeled with fluorescein isothiocyanate which retained biological activity and were used for binding studies. The binding of these drugs to HeLa cells was dependent on time and temperature, with 2 times more drug being bound at 37 degrees C than at 0 degree C. In the presence of a 100-fold molar excess of unlabeled NCS, the binding of smancs or NCS to HeLa cells was inhibited similarly. Therefore, it was suggested that smancs binds to NCS-binding sites (receptor) of the cell surface. However, the amount of cell-bound smancs was increased about 20-fold compared with that of NCS. Scatchard plot analyses of the binding of these drugs to HeLa and WISH cells indicated that this increase was due to alterations in affinity resulting from polymer conjugation of the drug to receptor rather than to an increase in the number of drug-binding sites at the cell surface. Furthermore, when the cytotoxicity of these drugs to HeLa cells was compared, smancs needed only 5 min to achieve 50% inhibition of the control. In contrast, the same dose level of NCS required more than 90 min to achieve the same toxic effect. More rapid internalization of smancs than NCS was also elucidated under fluorescence microscopy at 37 degrees C. There was no intracellular incorporation of these drugs below 20 degrees C. These results indicated that an increased lipophilicity of smancs appears to be responsible for its increased cell surface affinity, internalization rate, and toxic effect. Concordant to this interpretation was that among various copoly(styrene-maleic acid) esters, a more hydrophobic derivative showed more internalization (butyl greater than ethyl greater than carboxylate). These results suggest the possibility of utilizing protein tailoring to augment the subcellular activity of functional proteins.
The location of the pX gene products in human T-cell leukemia virus type 1-producing cells, MT-2 and HUT 102, was studied by immunoelectron microscopy using the direct and indirect peroxidase-labeled antibody methods. Fab'-peroxidase conjugates were prepared for the direct method with a maleimide compound from antisera to the carboxy-terminal region of the pX gene products. Positive immunostaining in MT-2 cells was detected in the endoplasmic reticulum, the outer and inner leaflets of the nuclear membrane, and inside their cisternae, but not in the plasma membrane and viral particles. Staining in the nucleus was faint. On the other hand, positive immunostaining in HUT 102 cells was detected diffusely in the euchromatin regions of the nucleus but not in the nucleoli, nuclear envelope, and cellular membrane systems. The location of the positive immunostaining in the HUT 102 nuclei was reconfirmed by the reaction in isolated nuclei. On the basis of both the immunoelectron microscopic and immunoblotting analyses of the pX gene products, it is suggested that the Mr 40,000 to 42,000 protein (p40x) is localized mainly in the euchromatin regions of the nuclei of human T-cell leukemia virus type 1-producing cells, and the Mr 68,000 protein (p68x) is localized mainly in the nuclear envelope and the endoplasmic reticulum of MT-2 cells. p68x detected in MT-2 cells with the anti-p40x serum was deduced to be a protein consisting of p40x and a part of env gene products and to share epitopes in common with p40x.
A method for electron microscopic demonstration of supranucleosomal (20-30 nm chromatin) fiber loops was developed. Chicken erythrocytes were treated with varying concentrations of detergents, such as Joy, sodium N-lauroyl sarcosinate, and sodium laurylsulfate, and then fixed with a formalin solution. The fixed cells were centrifuged onto an electron microscope grid, followed by staining and metal shadowing. Thin-sectioned specimens of the fixed cells were prepared routinely. Although supranucleosomal fiber loops could be observed when any one of these detergents was used, Joy gave the best result. Electron micrographs of rotary-shadowed specimens of erythrocyte ghosts formed by treatment with a low concentration (0.07-0.11 w/w%) of Joy showed a halolike, radial arrangement of supranucleosomal fiber loops around the ghost cells. The width of the halo was about 3 micron. By increasing the detergent concentration (approximately 8% Joy), nucleosome fibers and naked DNA appeared and increased in number, indicating that the supranucleosomal fibers were disassembled by the action of the detergent. Thin-sectioned specimens of cells treated with 0.09% Joy showed granulofibrillar chromatin radially dispersed from the nuclear cage. The fibers were thought to be identical with the supranucleosomal fibers observed in the rotary-shadowed specimens.