Biomedical subjects

S Oda

Publications and source records attributed to S Oda.

At least 127 records · Page 7Linked to original sources

PubMed1997

Novel smooth muscle cell lines from transgenic mice harboring temperature-sensitive SV40 large T-antigen gene. Temperature-dependent expression of smooth muscle myosin heavy chain-1 and calponin genes.

We have established novel vascular smooth muscle cell lines (SVS30 and SVS24 cells) which retain the expression of specific markers for smooth muscle cells, such as alpha-actin, smooth muscle myosin heavy chain-1, and calponin, from transgenic mice harboring the temperature-sensitive SV40 large T-antigen gene. SVS cell lines showed temperature-dependent growth and the expression of SV40 large T-antigen. Interestingly, protein and mRNA levels of smooth muscle myosin heavy chain-1 and calponin seen in culture at the non-permissive temperature (39 degrees C) were higher than those at the permissive temperature (33 degrees C). These results suggest that SV40 large T-antigen affects the expression of smooth muscle-specific markers in SVS cell lines, and that some of the characters in SVS cell lines can be controlled by culture temperature. SVS cell lines should be quite valuable tools with which to study the regulation of phenotypic modulation of smooth muscle cells, and to identify smooth muscle specific transcription factors which involve the expression of smooth muscle myosin heavy chain-1 and calponin genes.

Animals↗

PubMed1997

Life events and anxiety in Chinese medical students.

The authors studied a sample of 537 Chinese medical students aged 15-21 years using Zung's Self-Rating Anxiety Scale (SAS) and a life events checklist. The results showed that test pressure, less free time, peer competition, failure in a test, and financial problems were the most common stressful experiences for medical students during the previous 12 months. Social and personal problems were rated the highest on scores of perceived stress. Of all students, 12.5% scored over the cut-off point on the SAS previously established to indicate risk of psychiatric disorder. Using a stepwise regression analysis, it was shown that poor health status, little physical exercise, financial problems in the family, test pressure, conflict with classmates, the personality trait of introversion, getting up late in the morning, and freshman status were independently associated with the presence of anxiety.

Adolescent↗

PubMed1997

Pituitary adenoma with prolactin and growth hormone production in a sheep.

A pituitary adenoma was found in a 6-year-old ewe. This tumour was composed mainly of chromophobic cells, but acidophilic cells predominated in a few areas. Prolactin was demonstrated in the cytoplasm of some chromophobic cells by means of the immunoperoxidase technique, and secretory granules ranging in size from 100 to 900 nm in diameter were seen in all chromophobic cells examined. Almost all acidophilic cells were positive for growth hormone (GH), and a few of them were also positive for prolactin (PRL). This tumour resembled a human mixed GH cell-PRL cell adenoma.

Adenoma↗

PubMed1997

Ultrastructure and distribution of corticothalamic fiber terminals from the posterior cingulate cortex and the presubiculum to the anteroventral thalamic nucleus of the rat.

The ultrastructure of axon terminals in the anteroventral thalamic nucleus arising in the cingulate cortex and in the presubiculum was examined using the anterograde transport of wheat germ agglutinin conjugated to horseradish peroxidase in rats. Anterogradely labeled axonal arborizations arising from the posterior cingulate cortex were concentrated bilaterally in the ventral part of the anteroventral nucleus. In electron micrographs these thalamic terminals arising from the posterior cingulate cortex were consistently small, contained round vesicles, and established asymmetric contacts on distal dendritic processes. In contrast, the axonal arborizations arising from the presubiculum were concentrated ipsilaterally in the dorsal part of the anteroventral nucleus and comprised two identifiable populations of terminals. The smaller terminals, which contained densely packed round vesicles, established asymmetric synaptic contacts on distal dendritic processes and resembled the posterior cingulate cortex terminals described above. The other population of the presubiculum terminals consisted of medium-sized terminals. These contained loosely packed round vesicles and established asymmetric synaptic contacts on proximal dendritic processes. These results indicate that the posterior cingulate cortex and the presubiculum project differentially upon the anteroventral thalamic nucleus. They also indicate that although the posterior cingulate cortex gives rise to only one type of corticothalamic terminal, the presubiculum gives rise to two types of corticothalamic terminals. When taken together, these data suggest that these different limbic cortical areas might subserve distinct roles in the anteroventral thalamic nucleus function.

Animals↗

PubMed1997

Prognostic factors in delayed ischaemic deficit with vasospasm in patients undergoing early aneurysm surgery.

We have examined prognostic factors in delayed ischaemic deficit attributed to vasospasm following subarachnoid haemorrhage (SAH) and early aneurysm surgery. Among 605 patients with SAH, 201 patients developed a delayed ischaemic deficit and 137 of these underwent early surgery. These 137 patients were classified into groups A and B by outcome at 3 months after SAH (group A: the delayed ischaemic deficit was associated with an adverse outcome; group B: no adverse outcome). Factors indicating an unfavourable outcome were as follows: (i) older age; (ii) poor WFNS grade on admission; (iii) Fisher's scale of 4; (iv) intracerebral haemorrhage; (v) delayed ischaemic deficit following rerupture; (vi) complications of surgical intervention; (vii) delayed ischaemic deficit with disturbance of consciousness; (viii) lack of immediate improvement with hypervolaemic therapy; and (ix) intracranial complications after hypervolaemic therapy. We suggest that the reversibility of a delayed ischaemic deficit is determined by preceding brain damage and/or surgical complications.

Adult↗

PubMed1997

Pepsinogens and pepsins from house musk shrew, Suncus murinus: purification, characterization, determination of the amino-acid sequences of the activation segments, and analysis of proteolytic specificities.

Three pepsinogens, namely, pepsinogens A, C-1, and C-2, were purified from gastric mucosa of adult house musk shrew (Suncus murinus) by conventional chromatographic and gel filtration procedures. The molecular masses were 40, 39, and 41 kDa for pepsinogens A, C-1, and C-2, respectively. Pepsinogen C-2 contains an Asn-linked carbohydrate chain(s) of about 2 kDa. Each pepsinogen was converted to pepsin through an intermediate form under acidic conditions. By NH2-terminal sequence analysis of these protein species, the amino acid sequences of activation segments (proparts) of pepsinogens A and C-1 were determined to be LYKVPLVKKKSLRQNLIENGLLKDFLAKHNVNPASKYFPTE and KVTKVTLKKFKSIRENLREQGLLEDFLKTNHYDPAQKYHFGDF, respectively. The similarity of these two sequences is nearly 50%. Each pepsin cleaved preferentially peptide bonds between hydrophobic and aromatic amino acids, or bonds on either side of these amino acids. Although each activation segment had several sites susceptible to pepsin action, activation proceeded by limited cleavages of the segment, presumably due to the steric inflexibility of the segment in native pepsinogen. The activity of pepsin A was inhibited completely in the presence of a more than equimolar amount of pepstatin, while a hundred-molar excess amount of pepstatin was needed for the complete inhibition of the activity of pepsins C-1 and C-2.

Amino Acid Sequence↗

PubMed1997

Enhanced depressor effect of centrally administered high-calcium solution in salt-loaded experimental hypertension.

The depressor effect by oral calcium supplementation is known to be more pronounced in salt-dependent than in renin-dependent hypertension. This study was conducted to investigate the role of central calcium on two different pathophysiologic subtypes of experimental hypertension; (a) salt-dependent, deoxycorticosterone acetate-salt hypertensive rats (DOCA), and (b) renin-dependent, 2-kidney, 1 clip (2-K, 1C) hypertensive rats. In DOCA (n = 10), high-calcium solution (Ca+2, 65.2 mM, 10 microl) given centrally (i.c.v.) elicited a marked decrease in mean blood pressure (MBP; 170 +/- 4 to 138 +/- 5 mm Hg, p < 0.01) with a decrease in heart rate (HR; 390 +/- 18 to 344 +/- 17 beats/min, p < 0.05) lasting for 40 min. In 2-K, 1C (n = 10), high-Ca2+ i.c.v. showed a lesser decrease in MBP (178 +/- 4 to 171 +/- 5 mm Hg) and HR (419 +/- 10 to 395 +/- 12 beats/min) with shorter duration (for 20 min) than in DOCA. This significant depressor and bradycardic response to Ca2+ i.c.v. observed in DOCA was dose dependent at Ca2+ concentrations between 65.2 and 130.4 mM. In DOCA, high Ca2+ i.c.v. reduced the plasma noradrenaline (Nad) concentration significantly (479 +/- 81 to 319 +/- 62 pg/ml, p < 0.05). These results suggest that central Ca2+ plays a more important role in regulating sympathetic nerve activity and BP in salt-dependent than in renin-dependent experimental hypertension.

Animals↗

PubMed1997

Genetic mapping of genes regulating the thymus size in back-cross rats between the laboratory BUF/Mna strain and the MITE strain derived from the wild rat, Rattus norvegicus.

The thymoma prone BUF/Mna (B) rat is a useful model for studying the genes responsible for thymus enlargement during the stage of young growth. Among the strains of rats, B rats have the largest thymuses at all stages of life. A locus, Ten-1, which contributes to thymus enlargement in back-cross (BC) rats between the B and WKY/NCrj (W) strains, was mapped on chromosome 1. To determine the precise location of the locus, ¿B x(B x MITE)F1¿ BC rats were generated by crossing the B strain with the inbred MITE (M) strain, which was established from captured, Japanese wild rats, and were examined by linkage study using polymerase chain reaction with 67 microsatellite markers. Linkages with thymus enlargement were found in genotypes of seven markers, BSIS, LSN, MYL2, IGF2, PBPC2, D1Mgh11, and D1MIt6, by chi2-test and Student's t-test, which confirmed the presence of the genetic locus associated with thymus enlargement, Ten-1, in this region. Paradoxically, a suppressive locus, Tsu-1, to thymus enlargement was also found on chromosome 3, showing linkages of phenotype of the small thymus with genotypes of SCN2A, CAT, D3MIt16, and D3MIt13. By analyses of MAPMAKER/EXP and MAPMAKER/QTL, Ten-1 was mapped at 4.6 cM proximal from IGF2 locus on chromosome 1 and Tsu-1 at 4.0 cM proximal from CAT locus on chromosome 3, respectively.

Animals↗

PubMed1997

Prevalence of Actinobacillus actinomycetemcomitans serotypes in Japanese patients with periodontitis.

Oral Actinobacillus actinomycetemcomitans strains are serologically classified into 5 distinct groups, a to e. We examined the distribution of A. actinomycetemcomitans serotypes in Japanese patients with periodontitis. A total of 157 A. actinomycetemcomitans clinical isolates from diseased sites of 39 patients with periodontitis were serotyped by using serotype-specific rabbit antisera against A. actinomycetemcomitans serotypes a, b, c, d and e strains. In the immunodiffusion assay, autoclaved extracts of 42, 6, 39, 9 and 41 A. actinomycetemcomitans clinical isolates reacted with serotypes a, b, c, d and e antisera, respectively. Although 37 patients were infected with a serotype strain, 2 patients harbored 2 different serotype strains, b/e and b/untypeable. To establish a correlation between serotype and genotype of A. actinomycetemcomitans clinical isolates from 2 patients who had different serotype strains, we used arbitrarily primed polymerase chain reaction (AP-PCR) to fingerprint clinical isolates of different serotypes. The AP-PCR genotypes among 4 clinical isolates (b/e and b/untypeable) were identical to that of A. actinomycetemcomitans Y4 (serotype b), indicating the presence of multiple A. actinomycetemcomitans serotypes which are genetically homogeneous in the periodontally diseased sites of patients with periodontitis.

Actinobacillus Infections↗

PubMed1997

Efficacy and limitation of apheresis therapy in critical care.

Apheresis therapy such as plasma exchange and plasma adsorption has become therapeutic tools in critical care. The indications for apheresis therapy in ICU patients include fulminant hepatic failure, thrombotic thrombocytopenic purpura (TTP) and hemolytic uremic syndrome (HUS), autoimmune disease, and sepsis. During the past 11 years, 150 patients with various kinds of critical illnesses were treated with apheresis therapy in our ICU, and the overall survival rate was 50%. Apheresis therapy is especially useful in the treatment of a patient with fulminant hepatic failure because liver transplantation is seldom performed in Japan; therefore, the patient should be treated with artificial liver support. When plasma exchange is performed on the critically ill, continuous hemodiafiltration should be performed simultaneously to overcome the adverse effects of plasma exchange such as hypernatremia, metabolic alkalosis, and abrupt changes in colloid osmotic pressure and to enhance the removal rate of the causative middle molecular weight substances of hepatic failure or hepatic coma.

Autoimmune Diseases↗

PubMed1997

Investigation on the efficacy of povidone-iodine against antiseptic-resistant species.

The bactericidal activity of commonly used antiseptics against clinical isolates was determined. It is noteworthy that povidone-iodine (PVP-I) solution showed high bactericidal activity against all of the test strains after 30 s of exposure. However, in the case of chlorhexidine gluconate (CHG), residual bacteria were observed in most species. Next, acquisition of resistance to antiseptics was examined, and it was found that remarkable increases in MICs were seen for CHG and alkyldiaminoethylglycine hydrochloride. The strains which acquired resistance against one antiseptic showed cross-resistance to all antiseptics except for PVP-I. As for bactericidal activity against biofilm, no viable cells were seen after a 10-min exposure to PVP-I solution. No decrease in viable cell count was seen even after a 60-min exposure to any of the other antiseptics. PVP-I showed high activities in all the tests conducted in this study. Thus, PVP-I was confirmed to be a clinically useful antiseptic.

Anti-Infective Agents, Local↗

PubMed1997

Localization of the genes for major ribosomal RNA on chromosomes of the house musk shrew, Suncus murinus, at meiotic and mitotic cells by fluorescence in situ hybridization and silver staining.

The genes for major ribosomal RNA were localized on chromosomes 5pter-p15, 9q64-qter, and 13q38-qter of the house musk shrew, Suncus murinus (Insectivora, Soricidae) by silver staining of mitotic metaphase and meiotic pachytene spreads and fluorescence in situ hybridization using the human 28S-RNA genes as a probe to mitotic metaphase spreads. The data presented indicate a correlation between sites of in situ hybridization and silver staining. The finding of nuclear materials in mitosis was in a good agreement with observation in meiosis: same chromosomes carried active NORs in both meiotic and mitotic cells.

Animals↗

PubMed1997

Segregation analysis of animal pedigree data from inter-population crosses.

The general method of segregation analysis of pedigree data has been developed and widely used in human genetics. We modified this method to examine pedigree data coming from inter-population crosses. These kinds of pedigrees are common in laboratory and farm animal breeding. This paper describes a rationale for the method and illustrates its application to the study of inheritance of litter size and of male sterility in hybrid stock of the house musk shrew (Suncus murinus) derived from crosses of two geographically isolated populations.

Animals↗

PubMed1997

Inhibition of GH releasing factor (GRF)-induced GH secretion by intraruminal infusion of volatile fatty acids (VFA) in sheep.

A VFA mixture solution containing acetate, propionate and butyrate (the molar ratio of acetate, propionate and n-butyrate = 61.7:24.3:14.0) was infused into the rumen at various rates (53.5, 107 and 214 mumol kg-1 min-1) over 6 h to examine the effects on basal and growth hormone-releasing factor (GRF, 0.25 micrograms kg-1)-induced increase in secretion of GH, insulin, glucagon and somatostatin (SRIF) in five castrated male sheep. Intraruminal infusion of the VFA mixture into the 18-h-fasted animals at the rates of 53.5, 107 and 214 mumol kg-1 min-1 finally raised the total intraruminal VFA concentration from 91.4 to 100.2 (P > 0.05), 175.9 (P < 0.05) and 234.5 (P < 0.05) mmol l-1, respectively. A preliminary experiment showed that an infusion rate of 107 mumol kg-1 min-1 mimics the postprandial increase in ruminal VFA. The basal plasma GH concentrations (2 to 4 h after the start of VFA infusion) and the area under the profiles for GH release in response to the intravenous GRF injection, which was done 4 h after the start of VFA infusion, were significantly decreased by the VFA infusion rates of 107 and 214 mumol kg-1 min-1. Furthermore, the VFA infusion noticeably increased basal plasma concentrations of insulin, but it scarcely changed the basal levels of glucagon, SRIF and glucose. From these results we conclude that an increase in the ruminal VFA concentration, even within the physiological range, would suppress GH secretion from the ovine anterior pituitary, and that the postprandial rise in the ruminal VFA concentration may be one of the factors normally suppressing GH secretion in sheep.

Animals↗

PubMed1997

Ovulation induction and gamete transport in the female tract of the musk shrew, Suncus murinus.

The musk shrew Suncus murinus was studied with regard to induction of ovulation, the genesis and role of the vaginal copulation plug, and the behaviour of gametes and embryos within the Fallopian tube. Ovulation occurred about 15 h after ejaculation, which required a mean of 5.2 (range 2-10) intromittent thrusts. Since ovulation occurred also after five thrusts without ejaculation, and after ejaculation without plug formation or sperm deposition, the primary stimulus for this seemed to be the thrust of the penis, the glans of which was covered by a dense field of spines. Neither vasectomized nor prostatectomized males formed a plug at ejaculation, and in the latter case the mean number of spermatozoa reaching the isthmus of the Fallopian tube, the number at the ampullary fertilization site and the rate of fertilisation were lower than in females mated to normal males. Thus both the vesicular gland on the vas deferens and the prostate are essential for formation of the copulation plug, which appears to enhance sperm transport within the female tract. At ejaculation, < or = 10(6) spermatozoa were incarcerated by the plug in the anterior vagina for 6-7 h, by which time a maximal population of several hundred had become established in posterior crypts of the isthmus of the Fallopian tube as small groups of free languidly moving spermatozoa. It remains to be established whether oviductal crypts in this and other shrews have a storage function for spermatozoa or sequester spermatozoa and so regulate the number that reach the fertilization site. Very few spermatozoa reached the ampulla of Suncus. Generally, only one or two spermatozoa had reached the ampulla by 4-5 h, and often less than ten had done so by 5-13 h after ovulation. As a probable correlate, few eggs were penetrated during the first 5 h, with a frequent delay of 10-13 h before most eggs were fertilized. Thereafter, unfertilized eggs were transported through the oviduct at the same rate as developing embryos, which entered the uterus about 85 h after ovulation at the 32-cell stage. There were highly significant differences between the larger KAT/SK strains and smaller OK strain with regard to Fallopian tube length (mean 6.9 mm versus 9.7 mm), as well as the rates of hCG-induced ovulation (5.6 versus 3.25) and of unilateral ovulation (6% versus 50%).

Animals↗

PubMed1997

The unusual state of the cumulus oophorus and of sperm behaviour within it, in the musk shrew, Suncus murinus.

In the musk shrew, Suncus murinus, the behaviour of the cumulus-egg complex and its interaction with spermatozoa were unusual in several respects. The cumulus oophorus was ovulated about 15.5 h after mating or treatment with hCG as a hyaluronidase-insensitive matrix-free ball of cells which remained for relatively long periods of about 14 h around fertilized, and for about 24 h around unfertilized eggs. As a probable function of the small number of up to about 10 or 20 spermatozoa that generally reached the oviduct ampulla from isthmic crypts, there was often a delay of up to 10 h after ovulation before most eggs were penetrated. Soon after ovulation, however, the corona radiata retreated progressively from the zona pellucida, creating a closed perizonal space within the cumulus oophorus. Usually, most spermatozoa that did reach the ampulla were found within a cumulus and generally within that perizonal space. However, whereas the acrosome was intact among the few free ampullary spermatozoa, and in those adhering to the zona of cumulus-free eggs after delayed mating, all spermatozoa seen moving within the cumulus or adhering to the zona of unfertilized eggs had shed the giant acrosome. In accord with current observations in other shrews, the cumulus in Suncus may therefore function not only to sequester spermatozoa, but also as an essential mediator of fertilization-probably by inducing the acrosome reaction. In the absence of the acrosomal carapace that expresses the zona receptors in most mammals, fertilizing Suncus spermatozoa could use an unusual array of barbs on the exposed perforatorium to attach to the zona pellucida.

Acrosome↗

PubMed1997

Periodontal regeneration by application of recombinant human bone morphogenetic protein-2 to horizontal circumferential defects created by experimental periodontitis in beagle dogs.

The purpose of this study was to examine the regeneration of periodontal tissue after the application of recombinant human bone morphogenetic protein-2 (rhBMP-2) to horizontal circumferential defects created by experimental periodontitis. Twelve mandibular second premolars in 6 adult beagle dogs were subjected to experimental periodontal breakdown by placing silk ligatures around the teeth until the bone loss exceeded half of the root length. Flap surgery was then performed and the exposed cementum removed. The distance between the bone crest and cemento-enamel junction (CEJ) was about 5 mm. RhBMP-2 (40 micrograms/100 microliters) with a sponge-type carrier material made of gelatin and polylactic acid polyglycolic acid copolymer was placed in the furcation area (5 mm x 5 mm x 5 mm) and around the roots (10 mm x 5 mm x 2.5 mm x 2 pieces). In the control group, the same carrier material without rhBMP-2 was placed in the same manner. The flaps were replaced and sutured to cover these materials completely. Twelve weeks after surgery, the animals were sacrificed and serial sections were prepared in a bucco-lingual plane. Considerable new bone formation was observed in the rhBMP-2-treated sites. New cementum with Sharpey's fibers was observed on the instrumented root surface. On histometric analysis, the amount of new bone, new cementum, and connective tissue attachment was significantly greater in the rhBMP-2-treated group (paired t test; P < 0.01). These results indicate that suitable application of rhBMP-2 can produce considerable periodontal tissue regeneration, even in cases of horizontal circumferential defects.

Alveolar Bone Loss↗

PubMed1997

Motor control for bilateral muscular contractions in humans.

This article briefly reviews neural mechanisms responsible for bilateral simultaneous muscular contractions by analyzing force outputs and their underlying electromyogram (EMG) and electroencephalographic (EEG) activities. Two major issues were addressed from a series of studies concerning maximal and submaximal (20% of maximal voluntary contraction) bilateral contractions (i.e., mechanisms for the bilateral strength deficit and common drive). It is suggested that: (1) during maximal bilateral contractions there exists a common drive from the central nervous system to the right and left muscles and the bilateral strength deficit is due to the decreased neural activations of the precentral motor cortex of both hemispheres; and (2) during bilateral contractions at submaximal level, a common drive also exists for simultaneous use of homologous muscles and the submaximal bilateral contraction is coordinated mainly under the control of the left hemisphere for right-handed people.

Action Potentials↗