Biomedical subjects

S Noguchi

Publications and source records attributed to S Noguchi.

At least 487 records · Page 27Linked to original sources

PubMed1989

Enzyme immunoassay of estrogen and progesterone receptors in drill biopsy specimens from breast cancer.

We have applied enzyme immunoassay (EIA) to the detection of estrogen and progesterone receptors (ER and PR, respectively) in small samples obtained by drill biopsy of primary breast cancers. Thirty patients with breast cancer underwent drill biopsy of the tumors just before mastectomy. Both the drill biopsy and surgical specimens were assayed for ER and PR in the cytosol and nuclear fractions by EIA. ER and PR in the cytosol fraction (ERc and PRc, respectively) of the drill biopsy specimens (DBS) correlated very well with those of the surgical specimens (SS): ERc (DBS) = 1.02 X ERc (SS) + 3.85 fmol/mg protein (r = 0.958) and PRc (DBS) = 1.05 X PRc (SS) + 3.87 fmol/mg protein (r = 0.958). ER and PR in the nuclear fraction (ERn and PRn, respectively) of the drill biopsy specimens also correlated very well with those of the surgical specimens: ERn (DBS) = 1.02 X ERn (SS) + 59.18 fmol/mg DNA (r = 0.932) and PRn (DBS) = 0.98 X PRn (SS) + 54.28 fmol/mg DNA (r = 0.898). These results demonstrate that EIA for ER and PR of the drill biopsy specimens is a very useful method for the estimation of the receptor status of breast cancers.

Biopsy↗

PubMed1989

Effects of urinary transferrin and ornithine decarboxylase-inducing fraction on rat bladder carcinogenesis.

Using heterotopically transplanted rat urinary bladder (HTB) system, we previously have shown that contact with urine enhanced bladder carcinogenesis initiated by carcinogen. In order to screen urine for promoter substances, several short term in vitro assays were developed and their results were correlated with the in vivo assay results. Chromatographically separated urine fractions were examined for the inability to induce ornithine decarboxylase (ODC), to enhance incorporation of [3H]thymidine in a bladder carcinoma cell line (804G) and to form colonies in soft agar by NRK-49F. Data from the ODC assay and soft agar colony formation correlated well with the results derived from chronic animal studies. Thus then two assays appear useful in further screening urine for promoter substance. Data furthermore indicate that ODC-inducing urine component(s) may play a primary role in the steps following initiation whereas transferrin, a mitogenic urine component, may play a secondary role.

Animals↗

PubMed1989

The exogastrula-inducing peptides in embryos of the sea urchin, Anthocidaris crassispina--isolation and determination of the primary structure.

Four exogastrula-inducing peptides, A, B, C, and D have been isolated from the homogenates of embryos of the sea urchin, Anthocidaris crassispina, with successive chromatographic fractionations. The complete amino acid sequences of the peptides A and D were determined by analysis of the peptides generated by their digestion with lysyl endopeptidase. They were composed of 52 and 53 amino acid residues, and their molecular weights were calculated to be 5754 and 5737, respectively. The sequences of peptides A and D were DSVYQCNRDTNSCDGFGKCEKSTFGRTTGQYICNCDDGYRNNAYGGCSPRTE, and DTVARCERDTKNCDGHGTCQLSTFGRRTGQYICFCDAGYRKPNSYGGCSPSSA, respectively. The biological significance of the exogastrula-inducing peptides was discussed.

Amino Acid Sequence↗

PubMed1989

Effectiveness of discriminant analysis of serum CA 19-9 and elastase 1 in diagnosis of pancreatic carcinoma.

The accuracies of assays of serum CA 19-9 and elastase 1 in the diagnosis of pancreatic carcinoma were investigated by the cutoff method and discriminant analysis of data on 98 patients with pancreatitis, 65 patients with pancreatic carcinoma, 107 patients with benign diseases of other organs, and 108 patients with cancer of other organs. Comparison of the diagnostic accuracies of the cutoff method and multivariate analysis of CA 19-9 and elastase 1 showed that the latter was better for diagnosis in terms of its specificity. The performance of multivariate analysis was validated on independent data consisting of 52 patients with pancreatitis, 27 patients with pancreatic carcinoma, 79 patients with benign diseases of other organs, and 29 patients with cancer of other organs. Multivariate analysis of CA 19-9 and elastase 1 was very useful for differentiation of patients with and without pancreatic carcinoma: 24 (88.9%) of 27 patients with pancreatic carcinoma were correctly classified. Moreover, by this method, all patients with pancreatic carcinoma of less than 2 cm in longest diameter and 81.3% of those without jaundice were correctly classified.

Adult↗

PubMed1989

Influence of tamoxifen-medroxyprogesterone sequential therapy on estrogen and progesterone receptor contents of breast cancer.

The influence of tamoxifen (TAM) and medroxyprogesterone acetate (MPA) sequential administration on the estrogen receptor (ER) and progesterone receptor (PR) contents of breast cancer was studied in 68 patients with operable breast cancer. TAM was used as a primer of PR induction in order to enhance the effects of MPA. Half of the patients (n = 34) were preoperatively treated with TAM (20 mg/day for 7 days) and sequentially with MPA (1200 mg/day for 17 (median) days). ER and PR of surgical specimens were assayed by enzyme immunoassay and the results were compared with those obtained from the other half of the patients (n = 34), who had not received any treatment before surgery. TAM-MPA treatment significantly lowered PR in the cytosol regardless of the menopausal status. On the other hand, TAM-MPA treatment significantly lowered ER in the cytosol only in the postmenopausals but not in the premenopausals. These results demonstrate that reduction of ER provoked by TAM-MPA treatment is dependent on menopausal status.

Antineoplastic Combined Chemotherapy Protocols↗

PubMed1989

Induction of peroxidase and thyroglobulin by TSH in cultured thyroid cells from patients with Basedow's disease and its inhibition by actinomycin D.

The effects of TSH on peroxidase activity (PO) and thyroglobulin (TG) production were investigated using primary cultures of thyroid cells obtained from patients with Basedow's disease (Basedow's cells). PO activity of cultured cells and TG concentration in the culture medium were measured by biochemical and sandwich enzyme immunoassays, respectively. The addition of TSH (10 mU/ml/day) to the medium did not increase the cell number but did increase the PO activity and TG concentration. It took more than 3 days for the PO activity of cells cultured with TSH (stimulated group) to reach a level twice that of cells cultured without TSH (control group), whereas 2 days of incubation with TSH was sufficient for increasing the TG concentration. When actinomycin D (AD) was added to the medium on the first day of 3-day incubation with TSH, the stimulatory effect of TSH on PO was completely blocked and the TG concentration was reduced to half that of the control group. AD given to the stimulated group on the last day of induction produced no inhibitory effect on the induction of PO activity by TSH, but reduced the TG concentration to almost half that in the stimulated group. An electron microscopic study of Basedow's cells cultured with AD and TSH failed to reveal any cytopathic change. The findings of the present study suggested that in cultured Basedow's cells TSH induces PO activity and TG production through the synthesis of new messenger RNA.

Cell Count↗

PubMed1989

An immunohistochemical study of cytokeratin and vimentin in benign and malignant thyroid lesions.

Intermediate filaments in benign and malignant thyroid lesions were immunohistochemically studied using polyclonal and monoclonal anti-cytokeratin (CK), and monoclonal anti-vimentin antibodies. Antigenicity of CK and vimentin was almost completely destroyed during formalin fixation in normal thyroid and all thyroid lesions except for some cases of papillary and squamous cell carcinoma, although the latter showed negative immunostaining with anti-vimentin antibody. In sections fixed with Carnoy's fixative, most cases of papillary carcinoma showed an intense reaction product for polyclonal anti-CK, monoclonal anti-CK-7, CK-19 and anti-vimentin antibodies. The reaction product for anti-CK antibodies was located mainly in the apical cytoplasm and that for anti-vimentin antibody in the basal cytoplasm. However antigenicity was still destroyed by the fixative in many specimens of normal thyroid, benign thyroid lesions and follicular carcinoma. In frozen sections, all specimens showed preserved antigenicity for both antigens with an intense reaction product in papillary carcinoma, but this was weaker in normal thyroid, benign thyroid lesions and follicular carcinoma. Therefore, follicular cells under normal and pathological conditions contain intermediate filaments of CK and vimentin in their cytoplasm and co-expression of the antigens is significantly increased in papillary carcinoma.

Acetates↗

PubMed1989

Influence of adjuvant chemotherapy for operable breast cancer on results of treatment at relapse.

The influence of adjuvant chemotherapy (ACT) for operable breast cancer on the results of systemic therapy at relapse was retrospectively studied in 62 patients with recurrent disease. 32 had been treated with ACT [ACT (+) group] and the others had not [ACT (-) group]. The response rate (CR + PR) to the first treatment was 22% in the ACT (+) group and 43% in ACT (-) group. It is suggested that relapsing patients with a history of ACT respond poorly to the treatment as compared to those not receiving it.

Breast Neoplasms↗

PubMed1989

Impact of initial therapy on survival in recurrent breast cancer.

From 1976 to 1984, 135 recurrent breast cancer patients were treated with chemotherapy and/or additive endocrine therapy and their initial therapies and survival time were analyzed. Survival from the time of recurrence in these patients was longer than historical control patients (median 26 vs. 14 months). There was no statistical difference amongst the four groups which were subdivided by initial therapies after recurrence (tamoxifen alone, tamoxifen + tegafur, tamoxifen + other chemotherapy and chemotherapy). Therefore, the type of initial therapy did not affect the survival among these patients.

Adult↗

PubMed1989

Influence of 1 alpha,25-dihydroxyvitamin D3 on the development and steroid hormone receptor contents of DMBA-induced rat mammary tumors.

The influence of 1 alpha,25-dihydroxyvitamin D3 (1,25-(OH)2D3) on the development and steroid hormone receptor contents of 7,12-dimethylbenzanthracene (DMBA)-induced rat mammary tumors was evaluated. Neither the incidence nor the size of the tumors was affected by the 1,25-(OH)2D3 treatment (1 or 2 micrograms twice a week for 16 weeks) but estrogen and progesterone receptor contents of the tumors were significantly lower in 1,25-(OH)2D3-treated groups as compared to the control group. These results demonstrate that 1,25-(OH)2D3 at doses producing mild hypercalcemia does not affect the development of DMBA-induced rat mammary tumors but decreases the estrogen and progesterone receptor contents of the tumors.

9,10-Dimethyl-1,2-benzanthracene↗

PubMed1989

Effect of ultrasonic nebulization of Miraclid on the proteolytic activity in tracheobronchial secretions of rats.

Experimental studies of acute inflammation of the tracheobronchial lumen of rats suggest that protease inhibitor increases in tracheobronchial secretions in order to control inflammation. Recent studies have shown that the polyvalent protease inhibitor, Miraclid, derived from human urine, is useful for treating DIC and acute pancreatitis. In view of this information, local administration of Miraclid was expected to diminish acute inflammation of the respiratory tract by creating a favorable balance in the protease-antiprotease system. Before the chemotherapeutic use of locally administered Miraclid, the inhibitory activity of Miraclid on various proteases was first estimated in vitro. Administration of Miraclid by means of ultrasonic nebulization was then investigated in rats. The results can be summarized as follows. 1. During ultrasonic nebulization, the inhibitory activity of Miraclid on protease was decreased by means of mechanical stimulation in comparison to the activity before nebulization. 2. Compared to administration of physiological saline into the tracheobronchial lumen, administration of Miraclid by means of ultrasonic nebulization decreased the fibrinolytic activity in tracheobronchial secretions.

Aerosols↗

PubMed1989

Destructive thyrotoxicosis in a patient with anaplastic thyroid cancer.

A 55-year-old man was admitted to our hospital with an anterior neck tumor, hoarseness, and dysphagia that had continued for a few weeks. He was diagnosed as anaplastic thyroid cancer by fine-needle aspiration cytology. He was treated by external radiation and chemotherapy, but left hemothorax developed and he died of respiratory failure on the 76th day in hospital. On admission, the levels of serum free triiodothyronine (FT3), free thyroxine (FT4), and TSH were 12.8 pg/ml, 4.2 ng/dl, and 0 microU/ml, respectively. The simultaneous thyroidal I-131 uptake rate was 1.2% at 24 hours. The levels of free thyroid hormones fell gradually without antithyroid drugs to result in hypothyroidism (FT3 0.8 pg/ml, FT4 0 ng/dl, and TSH 36 microU/ml). The rapid growth of anaplastic thyroid cancer seemed to be responsible for destructive thyrotoxicosis followed by hypothyroidism in this patient.

Biopsy, Needle↗

PubMed1989

[Study on fatigue toughness of dental materials. 1. Compressive strength on various luting cements and composite resin cores].

In this study, we investigated compressive strength of various luting cements and composite resin cores in both dry and wet condition, and then influences of repeating load on compressive strength in wet condition of distilled water at 37 degrees C. As frequency of repeating load increased, compressive strength of all materials decreased. It means that the repeated load cycling test used in this study is adequate for evaluating durability of various dental materials. The results were as follows: 1. In the condition of no loading in both dry and wet condition, resin cement indicated the highest compressive strength of all cements examined and was followed by glass ionomer cement, zinc phosphate cement and polycarboxylate cement. Glass ionomer cement was notably influenced in wet condition. 2. After 10,000 cycles of loading in wet condition, resin cement indicated the highest compressive strength again and was followed by glass ionomer cement, polycarboxylate cement and zinc phosphate cement. In particular, compressive strength of zinc phosphate cement decreased remarkably. 3. In the condition of no loading, visible light-cured composite resin core was superior to chemical one. Visible light one was notably influenced in wet condition. 4. After 10,000 cycles of loading, visible light-cured composite resin core was superior to chemical one.

Composite Resins↗

PubMed1989

L-threo-3,4-dihydroxyphenylserine treatment for gait apraxia in parkinsonian patients.

L-threo-3,4-dihydroxyphenylserine (L-DOPS) was administered to six parkinsonian patients for the treatment of gait related akinesia which was refractile to L-DOPA treatment. One responded with marked improvement and one with only mild improvement. Although number of patients who respond markedly to this noradrenaline precursor, L-DOPS, is limited, L-DOPS was felt to be the most effective treatment modality for L-DOPA refractile gait related akinesia and L-DOPA related orthostatic hypotension.

Aged↗

PubMed1989

[Analysis of prognostic factors in patients with locally advanced breast cancer treated with intra-arterial infusion chemotherapy as an induction therapy].

A retrospective analysis was undertaken on a series of 75 patients with locally advanced breast cancer treated with intraarterial infusion chemotherapy as an induction therapy. Several parameters were tested as to possible prognostic variables. Of these, only histological assessment of local response influenced survival; patients with good histological response had a better prognosis than those with poor response (77% versus 47% survival at 5 years). Thus, histological effect appeared to be an important prognostic factor in this treatment strategy.

Adult↗

PubMed1989

[Results of tamoxifen-medroxyprogesterone acetate sequential therapy in 22 patients with recurrent breast cancer].

Effects of tamoxifen (TAM)-medroxyprogesterone (MPA) sequential therapy were evaluated in 22 patients with recurrent breast cancer. TAM-MPA therapy was given in the form of TAM 20 mg b.i.d. for 14 days followed by MPA 1200 mg t.i.d. for the subsequent 14 days, in alternating sequence. The response rate was 27% (6/22). Weight gain (greater than 5 kg) was observed in 18% (4/22) and this incidence was lower than that reported for MPA therapy. These results demonstrate that TAM-MPA therapy offers fewer side effects than MPA therapy, but response rate is unlikely to be improved.

Adult↗

PubMed1989

[Composite resin cores. Part 1. Comparison of various composite resin cores].

This study evaluated compressive strength, sealing ability and tensile bond strength of various materials of composite resin cores. 1. Compressive strength of the various materials, after they were placed in air for 24 hours, underwent thermal cycling testing, or were soaked in water for 2 weeks, ranged from 2000 kgf/cm2 to 2900 kgf/cm2. 2. The sealing ability after thermal cycling testing and being soaked in water for 2 weeks varied among the materials. 3. The bond strength of all composite resin core materials to dentin was less than 50 kgf/cm2. 4. In this study, no relationship was found between sealing ability and tensile bond strength.

Composite Resins↗

PubMed1988

Results of surgical treatment for sternal metastasis of breast cancer.

Nine patients with solitary sternal metastasis of breast carcinoma were treated aggressively, with partial (n = 8) or total (n = 1) resection of the sternum. Parasternal and mediastinal lymph node dissection also was performed concomitantly for every patient. Chest wall defects were reconstructed with acrylic resin plate (n = 3) or rectus abdominus myocutaneous flap (n = 6). All patients received chemoendocrine therapy postoperatively. The median survival of these nine patients was 30 months. The prognosis of the patients (n = 4) with the mediastinal or parasternal lymph node metastasis were poor and all of them died of second relapse within 30 months. The prognosis of those (n = 5) without the lymph node metastasis, however, was quite favorable; three survived more than 6 years. These results suggest that sternectomy should be indicated for the solitary sternal metastasis when no evidence of systemic spread is noted since it can improve the quality of life and occasionally may result in long-term survival.

Adult↗