Search PubMed⌕ Search

Biomedical subjects

M A Mitchell

Publications and source records attributed to M A Mitchell.

At least 73 records · Page 4Linked to original sources
PubMed1994

Bilateral renal parenchymal malacoplakia presenting as fever of unknown origin: case report and review.

Malacoplakia is a rare inflammatory disorder seen most often in the urinary tract, where it is highly associated with coliform infection. Although first recognized by pathologists in 1902, it has received little attention from the infectious disease community. While there remains much uncertainty regarding the specific cause of malacoplakia, it appears to be associated with a defect in intracellular killing of ingested microorganisms by macrophages. We report a case of bilateral renal parenchymal malacoplakia that presented as fever of unknown origin, and we review 33 previously identified cases. Renal malacoplakia has traditionally been associated with high morbidity and mortality. More recently, treatment with antimicrobial agents such as trimethoprim or ciprofloxacin has yielded a better outcome than had been documented with other therapy. Malacoplakia should be considered in the evaluation of fever of unknown origin or of relapsing or refractory urinary tract infection. Therapy with antimicrobial agents capable of intracellular penetration is recommended.

Anti-Infective Agents↗
PubMed1993

In vivo mutagenesis induced by CC-1065 and adozelesin DNA alkylation in a transgenic mouse model.

Although considerable work has focused on characterizing the bonding chemistry and sequence selective alkylation of DNA by cyclopropylpyrroloindole compounds, little is known about the molecular consequence of their N-3-adenine adducts in whole animal systems. We have utilized a transgenic mouse system, harboring a lambda phage shuttle vector, to assess the mutagenic potential of the antitumor compounds CC-1065 and adozelesin and, for the first time, to track the in vivo fate of their unique DNA modifications at the nucleotide level. Mice were inoculated with a single therapeutic dose of these agents and sacrificed at either 18 h, 3 days, or 15 days for extraction and analysis of liver DNA. Mutant frequencies obtained from drug treated and control animals were determined by in vitro packaging of the phage vector from genomic DNA followed by a colorimetric plaque assay to screen for phage in which the accompanying lacI repressor gene had mutated. Although undetectable at 18 h posttreatment, by 72 h a 3-fold increase in mutant frequency was observed in drug treated animals such that sequence analysis of drug induced mutations could be performed and a direct comparison made between in vitro and in vivo DNA alkylation. Base substitution involving guanine or cytosine accounted for 64% of the 41 mutations sequenced from drug treated animals. Only 7 of the mutations occurred at a cyclopropylpyrroloindole alkylation site while 23 occurred 1 to 4 nucleotides from a potentially alkylated adenine.

Alkylation↗
PubMed1993

Modulation of T lymphocyte function by the angiogenesis inhibitor AGM-1470.

The angiogenesis inhibitor AGM-1470 has recently been reported to inhibit collagen-induced arthritis in rats. To determine if the anti-arthritic effects of AGM-1470 might be due to T cell inhibition, we have studied its effects on T cell responses in vitro. Responses of human cells to tetanus toxoid (TT), and those of murine splenocytes to staphylococcal enterotoxin (SE), mitogens or a mls difference were inhibited by AGM-1470. Responses of human cells to SE, OKT3 and PHA were all partially inhibited on day 2 (d2) but not d3, and in fact were augmented on d6-8. The amount of IL-2 in SEA cultures was augmented on d4 and d5. There were no differences in the expression of CD3, CD4, CD8, CD25, CD45RA, CD45RO, LFA-1, VLA-4 or VLA-6 in inhibited cultures, except for slight decreases in CD25 and CD45RO in TT cultures. These results indicated that the angiogenesis inhibitor AGM-1470 also modulates human and murine lymphocyte function.

Animals↗
PubMed1993

Ultrastructural demonstration of mitochondrial calcium overload in myocardial cells from broiler chickens with ascites and induced hypoxia.

Two groups of young broiler chickens, namely, naturally occurring field cases of ascites and those with an induced hypoxia, were used in an ultrastructural study to examine the localisation and distribution of intracellular Ca2+ in cardiomyocytes. Age-matched healthy flockmates were used to control each group. Deposits of Ca2+ were located extensively in the mitochondria, sarcoplasmic reticulum and Golgi apparatus and sometimes in the myocyte and endothelial cell nuclei of both groups of birds. The results suggest that the cells from the hearts of the ascitic broilers may have been exposed to hypoxia since a large proportion of control material showed no Ca2+ activity in either mitochondria or nuclei. The presence of a Ca2+ overload in the mitochondria of cardiomyocytes from ascitic birds reared at low altitude or sea level suggests that these broilers were suffering from the deleterious effects of chronic hypoxia due to poor or reduced oxygen use.

Animals↗
PubMed1993

Enterocyte expression of calbindin, calbindin mRNA and calcium transport increases in jejunal tissue during onset of egg production in the fowl (Gallus domesticus).

1. Quantitative measurements of calbindin mRNA, calbindin protein and calcium uptake have been made in sectioned intestinal villi to determine the location and cellular characteristics of their expression in immature, point of lay and laying chickens. 2. Trace amounts of calbindin mRNA were detected by in situ hybridization in enterocytes located around the crypt-villus junction in jejunal tissue taken from immature and point of lay chickens. Large amounts of calbindin mRNA were detected in upper crypt and all villus enterocytes in tissue taken from laying chickens. Maximal levels of calbindin mRNA occurred in the basal third of the villus in laying chickens. 3. No calbindin was detected immunocytochemically in tissue taken from immature and point of lay chickens. Large amounts of calbindin were expressed in tissue taken from laying chickens. Maximal expression of calbindin in this case occurred in villus tip enterocytes. 4. Rapid uptake of calcium by tissue taken from laying chickens was twice that found in immature and point of lay birds. Calcium uptake in tissue taken from laying hens was also shown by quantitative autoradiography to take place maximally in villus tip enterocytes. 5. Regulation of calbindin gene expression and the cellular characteristics of calcium transport in laying chickens are discussed in terms of an adaptive response taking place in birds undergoing a daily loss of egg shell calcium.

Aging↗
PubMed1993

Multiple myeloma complicated by restrictive cardiomyopathy and cardiac tamponade.

Restrictive cardiomyopathy from amyloid deposition within the myocardium is a well-described complication of multiple myeloma; however, myelomatous involvement of pericardium with subsequent cardiac tamponade has rarely been described. Optimal treatment for malignant involvement of the pericardium by myeloma cells has yet to be established. The following description is of a patient with myocardial and pericardial manifestations of multiple myeloma. Treatment of the malignant pericardial effusion was implemented with intrapericardial administration of bleomycin. This therapy resulted in no recurrence of pericardial effusion at nine days follow-up. Despite the absence of detectable recurrent effusion, the patient died suddenly from causes felt unrelated to pericardial disease.

Aged↗
PubMed1992

Reversibility of the covalent reaction of CC-1065 and analogues with DNA.

Covalent DNA adducts of the antitumor antibiotic CC-1065 and its analogues undergo a retrohomologous Michael reaction in aqueous/organic solvent mixtures to regenerate the initial cyclopropylpyrroloindole (CPI) structure and, presumably, intact DNA. This reaction, which at higher temperatures competes with depurination of the N3-alkylated adenine, also occurs to a significant extent at 37 degrees C in neutral aqueous solution. Tritium-labeled adozelesin, covalently bonded to a 3-kilobase DNA restriction fragment which was exhaustively extracted to remove unbonded drug, was efficiently transferred to a 1-kilobase fragment upon coincubation for 20 h at 37 degrees C in aqueous buffer. Covalent adducts of adozelesin, but not CC-1065, on calf thymus DNA were cytotoxic to L1210 cells after incubation for 3 days at 37 degrees C, indicating that reversal of DNA alkylation can mediate potent cellular effects for simplified CC-1065 analogues.

Alkylation↗
PubMed1992

The effects of chronic exposure to elevated environmental temperature on intestinal morphology and nutrient absorption in the domestic fowl (Gallus domesticus).

1. Exposure of growing broiler chickens to elevated environmental temperature (35 degrees C) for two weeks, markedly reduced food intake (29%) and growth rate (37%) compared to birds maintained at 22 degrees C. 2. These changes in growth were accompanied by increased in vivo jejunal uptakes of galactose (36%) and methionine (50%) measured per unit intestinal dry weight. 3. Both the electrogenic (phloridzin sensitive) and non-electrogenic (phloridzin insensitive) components of galactose absorption were increased by 24 and 52% respectively during the chronic heat stress. 4. The size of the absorptive compartment may be reduced by the heat stress as reflected by decreased villus heights (19%) and wet (26%) and dry (31%) weights per unit length of jejunum. 5. It is suggested that the changes in hexose and amino acid during chronic exposure to elevated ambient temperature may reflect adaptations to optimise nutrient absorption in the face of reduced nutrition and decreases in the size of the absorptive compartment. A functional hypothyroidism (plasma luminal T3 decreased by 66%) associated with heat stress may contribute to the observed alterations in jejunal structure and function.

Animals↗
PubMed1992

Visualization of histamine binding to nuclei.

The binding of histamine to cultured microvascular endothelial cells and glycol methacrylate embedded ovarian tissue sections has been localized using fluorescein-albumin-histamine conjugate. Histamine conjugate was bound to the plasma membranes and nuclei of luteal, endothelial, and ovarian stromal cells. An apparent increase in the binding of histamine to nuclei was observed in the presence of cimetidine but the plasma membrane staining was still evident. Unlike cimetidine, pyrilamine completely inhibited the binding of histamine to the plasma membrane. Instead, in the presence of pyrilamine, histamine bound exclusively to the nuclei of endothelial, germinal epithelial, granulosa, and stromal cells. However, the nuclei of terminally differentiated luteal cells and oocytes were not labeled. The functional significance of these nuclear histamine binding sites remains to be determined.

Animals↗
PubMed1991

Electroporation of Haemophilus influenzae is effective for transformation of plasmid but not chromosomal DNA.

Electroporation of plasmid and chromosomal DNAs were tested in Haemophilus influenzae because of an interest in introducing DNA into mutants that are deficient in competence for transformation. The initial experiments were designed to investigate and optimize conditions for electroporation of H. influenzae. Plasmid DNA was introduced into the competence proficient strain Rd and its competence-deficient uptake mutants com-52, com-59, and com-88, and the recombination deficient mutant rec1. Plasmid DNA could also be electroporated into the non-transforming strains Ra, Rc, Re and Rf. Plasmid DNA without sequences that are involved in tight binding (uptake) of DNA by competent cells of H. influenzae Rd was electroporated into both competent and non-competent cells. Competent cells were several orders of magnitude less efficient than non-competent cells for electroporation of plasmid DNAs. Electroporation of H. influenzae chromosomal DNA was not successful. Low levels of integration of chromosomal markers were observed following electroporation and these could be ascribed to transformation. The treatment of cells with DNasel following electroporation separated the effects due to electroporation from those due to transformation. The DNasel treatment did not affect the efficiency of plasmid incorporation, but severely restricted effects due to natural DNA transformation.

Ampicillin Resistance↗
PubMed1991

The effects of genetic selection for increased growth rate on mucosal and muscle weights in the different regions of the small intestine of the domestic fowl (Gallus domesticus).

1. The total organ weights and the constituent weights of mucosal and muscle tissues have been determined in the small intestines of three lines of domestic fowls subjected to different degrees of artificial genetic selection for rapid growth rates. 2. Effects of selection have been examined on the basis of wet and dry tissue weights in duodenum, jejunum and ileum from each line of birds. 3. Effects of selection have been compared on both absolute tissue weights and relative weights (i.e. expressed per kilogram body weight). 4. Selection for rapid growth rate is associated with increases in absolute weight and length of small intestine but marked reductions in relative weight and length. 5. In the fastest growing group of birds the major effect is a decrease in the relative mass of mucosa which is most pronounced in the more proximal regions of the small intestine. 6. These findings are discussed in relation to possible enhancement of intestinal digestive and absorptive efficiency in birds selected for improved growth rate and feed conversion. 7. The differences in tissue composition of the small intestine between lines and between regions of the intestine in the same line emphasise the difficulty in selecting an anatomical parameter upon which to base the in vitro and in vivo measurements of nutrient absorption in a number of established preparations.

Animals↗
PubMed1991

Absorption of hexose and pentose sugars in vivo in perfused intestinal segments in the fowl.

1. Rates of absorption of two hexose (D-glucose and D-galactose) and two pentose (D-xylose and D-arabinose) sugars were measured by in vivo perfusion, in jejunum, ileum and (distal) caecum, in immature hens conditioned to either a standard (ST) or "high fibre" (ST + 20% grass) diet. 2. Each bird was tested in one intestinal segment with all four (U-14C-labelled, 10 mM) sugars, with either the hexoses preceding the pentoses or vice versa. 3. With all treatments, absorption rates of the hexoses were alike, as were those of the pentoses. Hexose absorption was twice as fast as pentose absorption in jejunum and ileum with both dietary pretreatments, whereas in caecum hexose and pentose rates were similarly high, except when pentose (and its associated fluid transfer) was apparently inhibited by prior hexose absorption with the ST diet. 4. With the ST diet, hexose absorption (per unit length and dry weight) was faster in caecum than in jejunum and ileum, and pentose absorption was also fastest in caecum when all pentose data from testing after hexose were excluded. 5. With the ST/grass diet, hexose absorption was faster in jejunum than in ileum and caecum when expressed per unit length, and pentose absorption was fastest in caecum on a dry weight basis. 6. Hexose absorption was faster in jejunum and slower in caecum with the ST/grass pretreatment than with ST. However, the dietary comparison was not conclusive because it involved birds form (two) different hatches (of similar age and weight) tested at different times.

Absorption↗
PubMed1991

Plasma zinc as an index of vitellogenin production and reproductive status in the domestic fowl.

1. A technique is described for the accurate determination of circulating vitellogenin concentrations by measurement of plasma zinc concentrations before and after selective precipitation of lipoproteins in the domestic fowl. 2. Vitellogenin zinc concentrations exhibit a high degree of correlation with those of another major egg yolk precursor, very low density lipoprotein (VLDL) in immature female birds, during developing and maximum egg production in mature birds and following cessation of egg laying. 3. Mature female patterns of plasma vitellogenin and VLDL were induced by injection of oestradiol 17 beta (5 mg/kg body weight per day for 3 days) into adult cockerels. 4. It is suggested that measurement of plasma zinc provides a simple and accurate technique for the estimation of vitellogenin production and reproductive status in the domestic fowl and that this may be applied to other oviparous vertebrates.

Aging↗
PubMed1990

The genome of Haemophilus influenzae Rd has a unique NotI site.

Previous analysis of physical maps of Haemophilus influenzae, which is circular and 1.9 Mb in length [Lee and Smith, J. Bacteriol. 170 (1988) 4402-4405; Kauc et al., J. Bacteriol. 171 (1989) 2474-2479], did not detect any NotI (GCGGCCGC) restriction sites. A transposon, Tn916, was constructed to contain a NotI linker cloned into its NciI site and introduced into the H. influenzae chromosome. NotI digestion of chromosomes containing a Tn916-associated NotI site followed by separation of fragments by field-inversion gel electrophoresis revealed the presence of two fragments obtained by two NotI cuts, one in Tn916 and the other, a unique, 'natural' NotI site in the original chromosomal DNA. The examination of other Haemophilus strains demonstrated the presence of one or more NotI sites in all of those tested.

Base Sequence↗
PubMed1990

SV40 large T-antigen nuclear signal analogues: successful nuclear targeting with bovine serum albumin but not low molecular weight fluorescent conjugates.

The signal sequence of a nuclear-directed protein encodes the necessary information for targeting the attached proteins to the cell nucleus. The sequence/structural requirements for a functional transport signal were explored with a series of peptides derived from the simian virus 40 large T-antigen nuclear signal 126-134 (CPKKKRKVED-NH2, wild type) conjugated to bovine serum albumin (BSA) through an N-terminal Cys (1) with m-maleimidobenzoyl-N-hydroxysuccinimide ester. Nuclear accumulation was virtually complete 15 min after microinjection into green monkey kidney cells (TC-7). Peptides with Asn, Orn, and Gln substituted for Lys128, the reverse wild-type peptide (DEVKRKKPC-NH2) and the long 34-residue wild-type analogue (CYDDEATADSQHSTPPKKKRKVEDPKDFESELLS-NH2), were synthesized and conjugated similarly to BSA. The Orn peptide and the 34-residue wild-type analogue conjugated to BSA also transported to the nucleus but at a slower rate than 1. The reverse wild-type, Asn- and Gln-BSA conjugates of these signal analogues did not show transport to the nucleus after 6 h of incubation. In an effort to learn if such signal sequences would also target a small molecule such as a fluorescent tag to the nucleus, 1 fluorescently tagged with monobromobimane was prepared and microinjected into TC-7 cells. The peptide was distributed throughout the cell. These results support the notion that a positively charged residue at position 128 is needed for rapid nuclear transport and that the intracellular transport machinery has spatial recognition. The results with fluorophore-peptide conjugates suggest nuclear localization of these low molecular weight peptides will be difficult to attain even if attached to a functional nuclear localization sequence.

Amino Acid Sequence↗