Search PubMed⌕ Search

Biomedical subjects

Jian Ding

Publications and source records attributed to Jian Ding.

106 records · Page 6Linked to original sources
PubMed2003

Synthesis and cytotoxicity of dihydroartemisinin ethers containing cyanoarylmethyl group.

A new type of ether of dihydroartemisinin containing cyano and aryl groups was prepared and tested for cytotoxicity to A549, P388, L1210 and HT29 cells using the MTT assay. 12k and 12l were the most cytotoxic compounds. 13 lacking the peroxy group showed a 1000-fold less potency than 12l. Similarly, the inactive compound 14 indicated that the position of cyano groups was also important. Flow cytometry data showed that the compounds caused an accumulation of P388 cells in the G(1)-phase of the cell cycle.

Animals↗
PubMed2003

Quercetin, a dietary-derived flavonoid, possesses antiangiogenic potential.

Quercetin, a dietary-derived flavonoid, suppresses tumor growth in vitro and in vivo, and inhibits the activity of tyrosine kinase. The effects of quercetin on the angiogenic process were examined in this study. Quercetin was found to inhibit several important steps of angiogenesis including proliferation, migration, and tube formation of human microvascular dermal endothelial cells in a dose-dependent manner. Additionally, the effect of quercetin on endothelial cell proliferation was confirmed using human umbilical vein endothelial cells. The activity of quercetin on the proliferation of endothelial cells was stronger than that on A549, BEL-7402, MKN-45 tumor cells and NIH-3T3 fibroblast cells. The chicken chorioallantoic membrane assay revealed that addition of quercetin displayed an antiangiogenic effect in vivo. After exposure to quercetin, a decrease in the expression and activity of matrix metalloproteinase-2, which is involved in the angiogenic process of migration, invasion, and tube formation, was observed by reverse transcription-polymerase chain reaction (RT-PCR) and gelatin zymography. These findings suggest that quercetin has antiangiogenic potential and that this effect may be related to an influence on the expression and activity of matrix metalloproteinase-2.

Angiogenesis Inhibitors↗
PubMed2003

Novel Cu(II)-quinoline carboxamide complexes: structural characterization, cytotoxicity and reactivity towards 5'-GMP.

Three new ligands, N-(8-quinolyl)pyridine-2-carboxamide (HL1), N-(8-quinolyl)glycine-N'-Boc-carboxamide (HL2), N-(8-quinolyl)-L-alanine-N'-Boc-carboxamide (HL3), and their Cu(II) complexes have been synthesized. Crystallographic data reveal that complex I, [Cu(L1)(Ac)(H2O)], is penta-coordinated with a square-pyramidal geometry while complexes V [Cu(L2')(H2O)] and VI [Cu(L3')(H2O)] are tetra-coordinated to give square planar geometry. In vitro tests showed that the Cu(II) complexes with L1 (I-IV) exhibited cytotoxicity at a concentration of 10(-8) M against murine leukemia P-388 and human leukemia HL-60 cell lines, which is more potent than cisplatin. However, ligands HL2 and HL3 and their corresponding copper complexes demonstrated very weak in vitro activities towards the cell lines examined. ESMS data shows that complex I binds rapidly with 5'-GMP to form 1:1 and 2:2 adduct.

Alanine↗
PubMed2003

Recombinant protein comprising multi-neutralizing epitopes induced high titer of antibodies against influenza A virus.

In previous studies, we suggested that epitope-vaccine might be a new strategy against virus infection. Based on this hypothesis, we designed and expressed a recombinant immunogen (multi-epitope-peptide) comprising repeats of three neutralizing-epitopes (neutralizing epitopes: aa92-105, 127-133 and 183-195) of hemagglutininin (HA) of influenza virus (H3N2) in E. coli. After vaccination, the recombinant multi-epitope protein could induce a high level of antibodies with predefined multi-epitope-specificity in mice and rabbits. The epitope-specific antibodies in sera were tested using three different epitope-peptides (synthetic peptides) in ELISA assay, and the serum dilutions from 1 : 6400 to 1 : 25600 were confirmed. In western blot analysis, both the antiserum and the antibodies purified by synthetic epitope-peptide coupled sepharose columns could recognize natural HA from influenza virus particles (strain A/Wuhan/359/95 H3N2). In hemagglutination inhibition (HI) tests, these three antisera at the dilutions from 1 : 20 to 1 : 80 showed inhibitory activity. Interestingly, antisera and purified antibodies induced by the epitope-vaccine could partially inhibit plaque-formation of influenza virus (strain A/Wuhan/359/95) on MDCK cell monolayers. These results suggest that the recombinant multi-epitope vaccine can simultaneously induce multi-antiviral activities against influenza virus, which may provide a new way to develop effective vaccines against influenza virus.

Animals↗
PubMed2003

Studies of marine sulfated polymannuroguluronate on endothelial cell proliferation and endothelial immunity and related mechanisms.

Anti-proliferation action and enhancement of endothelial cell immunity and related mechanisms by marine sulfated polymannuroguluronate (SPMG) were investigated in the present studies. Endothelial cell proliferation was evaluated by MTT assay. Intercellular adhesion molecule-1 (ICAM-1) expression was analyzed by flow cytometry. The interaction of SPMG with basic fibroblast growth factor (bFGF) was evaluated by surface plasmon resonance. Results showed that SPMG exhibited a significant inhibitory effect against proliferation in both normal human umbilical vein endothelial cells (HUVEC) and bFGF-treated HUVEC, the action of which was completely abrogated by bFGF antibody. SPMG exerted high affinity to bFGF in a multivalent pattern, characterized by one molecule SPMG binding to 3 - 4 molecules of bFGF. Moreover, SPMG enhanced ICAM-1 expression in HUVEC and prevented and restored bFGF-treated downregulation of ICAM-1 expression in HUVEC, the expression of which was not counteracted by bFGF antibody. In conclusion, this is the first report demonstrating that SPMG exerted an anti-proliferation effect dependent on the bFGF-regulated pathway and afforded upregulatory activity on ICAM-1 expression regardless of the involvement of bFGF.

Alginates↗
PubMed2003

[Protein phosphatase 2A: its structure, function and activity regulation].

Protein phosphatase 2A (PP2A) is a major kind of serine/threonine protein phosphatase in eukaryotic cells. PP2A has many subunits and isozymes encoded by different genes to form many different PP2A holoenzymes. PP2A plays important roles in regulation of cell cycle, signal transduction, cell differentiation, and transformation. Its activity is related to several diseases, including neurodegenerative diseases and cancer. The regulation of PP2A activity is accomplished by its subunits' expression, cellular localization, phosphorylation and methylation. The second messenger, ceramide, also plays an important role in the regulation of PP2A activity, as well as a plenty of low molecular mass inhibitors of PP2A and other protein phosphatases.

Animals↗
PubMed2003

Actinomycin D inhibiting K562 cell apoptosis elicited by salvicine but not decreasing its cytotoxicity.

AIM: To study the effects of actinomycin D (Act D) on the cytotoxicity and apoptosis elicited by salvicine in human leukemia K562 cells. METHODS: Growth inhibition of K562 cells was measured by the microculture tetrozolium (MTT) assay. Cell apoptosis was evaluated by fluorescence microscopy, DNA agarose gel electrophoresis, and flow cytometry. RESULTS: Following exposure of K-562 cells to salvicine plus Act D for 24 h, Act D at the concentrations of 0.04, 0.4, and 4 micromol/L potentiated the cytotoxicity of salvicine 6.25 micromol/L to some degree. The mean growth inhibitory rates went from 8 % up to 69 %, 71 %, and 70 %, respectively. However, the same enhancement of Act D did not continue to emerge at the higher concentrations than salvicine 6.25 micromol/L. Act D enhanced, or at least, did not decrease the cytotoxicity of salvicine against K562 cells. Fluorescence microscopy, DNA agarose gel electrophoresis, and flow cytometry revealed that Act D concentration-dependently inhibited the induction of apoptosis by salvicine in the same cell line. CONCLUSION: The combination of salvicine and Act D in a proper range of concentrations is able to enhance the cytotoxicity of salvicine against K562 cells though inhibiting apoptosis. The other mechanisms of cell death except apoptosis may be implicated in the process.

Antibiotics, Antineoplastic↗
PubMed2003

[Research advances on circumventing tumor multidrug resistance].

Tumor multidrug-resistant(MDR) reverters inhibit the function of drug transporters and thus reverse MDR. In contrast,anti-MDR agents circumvent tumor MDR by directly inhibiting or killing MDR tumor. In recent years, the development of novel anti-MDR agents has become a major focus of research. This review summarized the advances in MDR mechanisms concentrating on the relationships between P-glycoprotein and apoptotic regulation and between ceramide signal system and MDR. With this understanding, the authors classified anti-MDR agents for the first time as agents which are structurally modified from MDR-related drugs, disrupt MDR mechanisms, induce caspase-independent apoptosis, interfere with ceramide metabolism, and are mechanism-unknown. Meanwhile, their mechanisms and major features of actions were also discussed.

ATP Binding Cassette Transporter, Subfamily B, Mem↗
PubMed2002

Down-regulation of telomerase activity via protein phosphatase 2A activation in salvicine-induced human leukemia HL-60 cell apoptosis.

Salvicine is a novel topoisomerase II inhibitor possessing significant antitumor activity, both in vitro and in vivo. The antitumor effect of salvicine is associated with its ability to induce tumor cell apoptosis. Telomerase plays an important role in the apoptotic pathway. However, little is known about the mechanisms of telomerase regulation during apoptosis induced by anticancer drugs. This study investigated the regulation of telomerase activity in salvicine-induced human leukemia HL-60 cell apoptosis. Salvicine treatment resulted in HL-60 cell apoptosis and down-regulation of telomerase activity in a time- and concentration-dependent manner. Repression of telomerase activity preceded a decrease in expression of the telomerase catalytic subunit (hTERT) and telomerase-associated protein (TP1) at the mRNA level, suggesting that the salvicine-induced decrease in telomerase activity may be additionally regulated by mechanisms other than telomerase subunit transcription. We observed that okadaic acid (OA), a protein phosphatase inhibitor, prevented the induction of apoptosis and the down-regulation of telomerase activity by salvicine. The significant increase in protein phosphatase 2A (PP2A) activity induced by salvicine treatment was blocked completely by OA. Moreover, although salvicine induced HL-60 cell apoptosis in a caspase-3-dependent manner, a specific caspase-3 inhibitor, Z-DEVD-FMK, did not prevent a decrease in telomerase activity or an increase in PP2A activity in apoptotic HL-60 cells, ruling out a role for caspase-3 in PP2A activation by salvicine. The results collectively suggest that the salvicine-induced decline in telomerase activity is not a consequence of HL-60 cell apoptosis and that it may be caused principally by the dephosphorylation of telomerase components mediated by PP2A activation.

Apoptosis↗
PubMed2002

Recombinant multi-epitope vaccine induce predefined epitope-specific antibodies against HIV-1.

Monoclonal antibody 2F5 recognizing ELDKWA-epitope on HIV-1 gp41 has significant neutralization potency against 90% of the investigated viruses of African, Asia, American and European strains, but antibodies responses to ELDKWA-epitope in HIV-1 infected individuals were very low. Based on the epitope-vaccine strategy suggested by us, a recombinant glutathione S-transferase (GST) fusion protein (GST-MELDKWAGELDKWAGELDKWAVDIGPGRAFYGPGRAFYGPGRAFY) as vaccine antigen containing three repeats of neutralizing epitope ELDKWA on gp41 and GPGRAFY on gp120 was designed and expressed in Escherichia coli. After vaccination course, the recombinant multi-epitope vaccine could induce high levels of predefined multi-epitope-specific antibodies in mice. These antibodies in sera could bind to both neutralizing epitopes on gp41 peptide, V3 loop peptide and recombinant soluble gp41 (aa539-684) in ELISA assay (antisera dilution: 1:1,600-25,600), while normal sera did not. Moreover, these antibodies in sera could recognize the CHO-WT cells which expressed HIV-1 envelope glycoprotein on the cell surfaces, indicating that the predefined epitope-specific antibodies could recognize natural envelope protein of HIV-1 though these antibodies were induced by recombinant multi-epitope-vaccine. These experimental results suggested a possible way to develop recombinant multi-epitope vaccine inducing multi-antiviral activities against HIV-1.

AIDS Vaccines↗
PubMed2002

Bioactive abietane and seco-abietane diterpenoids from Salvia prionitis.

From the roots of Salvia prionitis a new tricyclic diterpene, saprirearine (1), a new anhydride-type compound, saprionide (2), a new 7,8-seco-abietane diterpene derivative, 7,8-seco-para-ferruginone (3), and two new 4,5-seco-5,10-friedo-abietane diterpenoids, 4-hydroxysaprorthoquinone (4) and 3-keto-4-hydroxysaprorthoquinone (5), were isolated. Their structures were established by spectroscopic methods and chemical transformation. Compound 3 showed antimicrobial activities against two Gram-positive organisms, Staphylococcus aureus and Micrococcus luteus, with MIC values of 20.0 and 15.0 microM, respectively. Compound 4 showed significant inhibition against topoisomerase Iota with an IC50 value of 0.8 microM. Compound 5 exhibited cytotoxic activities against HL-60 human leukemia and the SGC-7901 and MKN-28 stomach cancer cell lines, with IC50 values of 4.6, 0.2, and 0.3 microM, respectively.

Anti-Bacterial Agents↗
PubMed2002

A candidate vaccine against influenza virus intensively improved the immunogenicity of a neutralizing epitope.

BACKGROUND: The hemagglutinin (HA) of influenza viruses is one of the major targets of the humoral response. The role of serum antibody to HA in the protection against infection has been demonstrated by long-standing observation. In previous studies, we suggested that an epitope vaccine might be a new strategy against the virus. METHODS: HA sequences of 491 H3 subtype strains from the influenza sequence database were compared and analyzed. To acquire information on the immunogenicity of the F3 epitope, F3-epitope-specific antibody levels in 81 patient sera infected with influenza virus were tested by ELISA. Based on the theory of the epitope vaccine, we designed an epitope peptide F3 (C-KAYSNCYPYDVPDY-G-KAYSNCYPYDVPDY), which contains the repeated F3 epitope KAYSNCYPYDVPDY (aa92-105) on HA (H3N2). The specificity and the titer of the antibodies induced by the epitope vaccine were determined by ELISA. The neutralizing activities of these anti-F3 antibodies were shown by inhibiting influenza virus infection of MDCK cells. RESULTS AND CONCLUSION: Comparison of HA sequences of 491 H3 subtype strains indicates that this epitope is highly conservative. Analysis of the sera from influenza virus-infected patients revealed a very low level of F3 epitope-specific antibodies, suggesting the poor immunogenicity of the F3 epitope on influenza virus. The epitope vaccine based on the F3 epitope induced high levels of F3 epitope-specific antibodies recognizing the epitope peptide F3 (antibody titer in antisera up to 1:25,600). Besides, the antisera could also recognize the natural HA in Western blotting. Interestingly, these antisera induced by the epitope vaccine could inhibit infection of MDCK cells by influenza virus (strain A/Wuhan/359/95) in the neutralization assay. These results suggest that the epitope vaccine can intensively increase the immunogenicity of neutralizing epitopes and may provide a new way to develop an effective vaccine against influenza virus.

Animals↗
PubMed2002

[Inhibition of mixture of lucid garoderma and lucid garoderma spore on tumor cell in vitro and in vivo].

BACKGROUND & OBJECTIVE: Garoderma lucidum (lingzhi) is a kind of medicinal fungus with a long history in China as a valuable tonic folk remedy. It has been demonstrated that lingzhi had growth inhibition effect against implanted mice tumors. It is generally regarded that anti-tumor action of lingzhi is induced by promoting function of immune system. Recently, we found that mixture of lucid garoderma and lucid garoderma spore (MLGLGS) could markedly inhibit activities of topoisomerase I and II, so this study was designed to further evaluate the inhibition effects of MLGLGS on tumor cell in vitro and in vivo. METHODS: Inhibition of MLGLGS on tumor cell were detected by MTT or SRB method in vitro study and by human tumor nude mice xenografts as models in vivo study. RESULTS: Among them, the IC50 values were lower than 2 mg/ml in P388, U-937, and HL-60 leukemias, and lower than 4 mg/ml in 2 human lung cancer and 2 human gastric cancer cells, respectively. In vivo study revealed that MLGLGS had certain experimental therapeutic action on human lung tumor xenograft LAX-83 (dose: 1 g/kg, inhibitory rate: 49.47%) and gastric xenograft SGC-7901 (dose: 2 g/kg, inhibitory rate: 43.09%). CONCLUSION: MLGLGS has inhibitory action on tumor cell at high concentration and high dosage.

Animals↗
PubMed1998

Simplified isolation and spheroidal aggregate culture of rat hepatocytes.

AIM:To explore a simplified method for isolation of hepatocytes and establish a method of primary hepatocyte culture with more aggregates and longer persisence.METHODS: Wistar rat hepatocytes were isolated by a single extracorporeal two-step perfusion method, and the cells were seeded on poly-HEMA coated flasks and cultured with hormonally defined medium and gentle shaking at regular intervals.RESULTS: The total yield of isolating hepatocytes amounted to 10(8) cells for each rat liver with the viability of more than 90% in all isolations. Under the nonadherent environments, the cells were found to attach to each other and form multicellular aggregates rapidly, and the aggregates became spheroidal shape after two days in culture. The morphologic characteristics and albumin synthetic unction of the multicellular spheroidal aggregates can be maintained for one month.CONCLUSION: The simple and reliable isolation as well as large scale and longer time culture of hepatocytes can be used for experiments in liver cell transplantation and bioartificial liver support system.

Journal Article↗