Search PubMed⌕ Search

Biomedical subjects

C A Phillips

Publications and source records attributed to C A Phillips.

At least 73 records · Page 4Linked to original sources
PubMed1989

Functional electrical stimulation and lower extremity bracing for ambulation exercise of the spinal cord injured individual: a medically prescribed system.

The purpose of this study was to determine whether commercially available electrical muscle stimulators could provide functional ambulation exercise for the spinal cord injured individual. Commercially available electrical muscle stimulators were used for functional electrical stimulation and interfaced with reciprocating gait orthoses so that a new system has been developed. Advantages of the system include commercially available subsystems and subsystems for applications such as gait training. The system involves six electrical stimulation units worn on a belt; controlled by remote switches; and interfacing to electrodes placed over the quadriceps femoris, hamstring, and gluteal muscle groups of each leg. Four electrical stimulation units (for quadriceps femoris muscle stimulation) function primarily for stand-up and sit-down activities. Two other units (for stimulation of the hip extensor muscles) function primarily for ambulation. The system is described for use with a C7-level quadriplegic individual. The patient successfully performed over 20 repetitions of stand-up and sit down exercises with the system. An average walking distance of about 0.8 km was routinely traversed at velocities ranging from 1.2 to 2.0 km per hour. It was concluded that muscle fatigue, rather than battery power, was the functionally limiting factor for the quadriplegic patient. A recommendation is that application of the system for walking exercise should be preceded by a physical conditioning program of functional electrical stimulation. Specific medical criteria should be satisfied prior to formally prescribing the system for an individual. Finally, the steps involved in the writing of the walking system prescription are outlined.

Adult↗
PubMed1989

Muscular, respiratory and cardiovascular responses of quadriplegic persons to an F. E. S. bicycle ergometer conditioning program.

Seven quadriplegic subjects participated in F. E. S. bicycle ergometry, three times per week, over an eight week period. Left thigh girth measured at 20 cm above the knee increased from 44.4 cm pre-training to 46.5 cm post-training (p less than 0.05), and right thigh girth increased from 44.3 cm to 46.2 cm (p less than 0.05). Forced vital capacity increased from 3.23 liters (pre-training) to 3.42 liters (post-training) and was significant at the p less than 0.05 level. Forced inspiratory capacity increased for 3.30 liters, pre-training, to 3.42 liters, post-training (p less than 0.05). FEV1 (liters) increased from 2.77, pre-training to 3.07 post-training (p less than 0.05). All three respiratory parameters were 55%-60% of that predicted for normals. Significant changes were also found in resting cardiovascular data. Mean resting heart rate, pre-training, was 51.4 beats per minute compared to 54.5 beats per minute, post-training, (p less than 0.05). Resting cardiac output, pre-training was 4.14 L/min. compared to 4.47 L/min., post-training (p less than 0.05). Further analysis of the cardiovascular data showed that the increased heart rate post-training was associated with a decrease in the P-R interval from 0.186 sec., pre-training to 0.170 sec., post-training (p less than 0.05). Also, the increase in cardiac output, post-training was matched by an increase in the cardiac index from 2.21 L/min./M, pre-training, to 2.36 L/min./M, post-training (p less than 0.05). A statistically significant difference in the heart rate response to the cold pressor test was demonstrated (p less than 0.05) and a similar difference in the amount of heart rate response was seen during the tilt table test (p = 0.05).

Adolescent↗
PubMed1988

Sensory feedback control of upper- and lower-extremity motor prostheses.

The topic is introduced with a conceptual definition of sensory feedback control applied to prosthetic systems. An overview of sensory physiology is then provided. Tactile sensation and audition are specifically discussed. Next, the artificial sensory systems are evaluated. This is done with respect to sensory (input) transducers, signal encoding/decoding, and sensing output transducers. Specific prosthetic systems are then reviewed. First, upper-extremity prostheses are reviewed with respect to artificial arm/hand systems as well as neuroprostheses. Next, lower-extremity prostheses are reviewed, and include both artificial leg and foot systems as well as neuroprostheses. Finally, conclusions are drawn regarding effective state-of-the-art sensory feedback control used with orthotic and prosthetic systems.

Artificial Limbs↗
PubMed1987

Covalent labeling of mu opioid binding site by [3H]beta-funaltrexamine.

[3H]beta-funaltrexamine ([3H]beta-FNA) bound irreversibly to bovine striatal membranes. Naloxone inhibited the irreversible binding of 5 nM [3H]beta-FNA in a dose-dependent manner and maximally inhibited this binding at approximately 1 microM. Thus, the specific irreversible binding of [3H]beta-FNA to opioid receptors was defined as that which could be inhibited by 1 microM naloxone. This specific irreversible binding of [3H]beta-FNA was characterized. Exclusion of Na+ from the incubation medium reduced the specific binding of [3H]beta-FNA, and Na+ could be substituted by Li+ but not by K+, Cs+, Mg2+, or guanylylimidodiphosphate. The specific irreversible binding was saturable, time- and temperature-dependent, and was linearly related to tissue mass. Several drugs were used to characterize this specific binding. Levorphanol was 1000 times more potent as an inhibitor than dextrorphan. mu Opioid ligands (sufentanil and morphine) were much better inhibitors than delta (ICI174,864) or kappa (U50,488H) ligands. The potency of [D-Ala2, D-Leu5]enkephalin (DADLE) was between those of sufentanil and ICI174,864. These results demonstrated that under appropriate conditions [3H]beta-FNA specifically and irreversibly bound to the mu opioid binding site. Membrane preparations labeled with [3H]beta-FNA in the presence or absence of 1 microM naloxone or beta-FNA were subjected to polyacrylamide gel electrophoresis under denaturing and reducing conditions. Fluorograms showed that [3H]beta-FNA specifically bound to a protein (most likely the mu opioid binding site) that migrated as a band with a molecular weight range of 68,000-97,000. Such electrophoretic behavior indicates that it is likely to be a glycoprotein. The glycoprotein nature was confirmed by its adsorption onto a wheat germ lectin-Sepharose column after solubilization and subsequent elution by N-acetyl-D-glucosamine. In this lectin column eluate, the mu opioid receptor was the only protein band labeled by [3H]beta-FNA in the total binding preparation, and no labeled protein was observed in the nonspecific binding preparation. When the wheat germ lectin column eluate of the total binding was treated with peptide:N-glycosidase F, the broad labeled band of Mr 68,000-97,000 became a sharp band of Mr 57,000 with high radioactivity and a faintly labeled band of Mr 49,000.

Animals↗
PubMed1987

Medical criteria for active physical therapy. Physician guidelines for patient participation in a program of functional electrical rehabilitation.

Medical guidelines are presented by which the physician may evaluate a patient for participation in a program of active physical therapy (A.P.T.). A.P.T. system modalities are introduced and defined as: a) isokinetic leg trainer, b) stationary bicycle ergometer, c) outdoor exercise bicycle, and d) Functional Electrical Stimulation (F.E.S.)--Orthosis for ambulation. The physiological responses to these F.E.S. exercise modalities are reviewed. Initial and interim patient evaluations are discussed. The initial patient evaluation includes a history, physical examination, lab tests, and a report summary, all of which culminate in an F.E.S. exercise prescription. The interim patient evaluation is performed for continuation-termination purposes as well as to progress the patient through the various F.E.S. exercise modalities. Specific F.E.S. exercise progression criteria are summarized. The medical criteria are presented with respect to both patient participation in the F.E.S. exercise program and patient monitoring during the exercise itself. Specific medical criteria for patient participation in A.P.T. are organized around eight functional categories: a) level of neurological injury, b) muscular system, c) skeletal system, subdivided into bone criteria and joint criteria, d) cardiovascular system, e) respiratory system, f) urogenital system, g) cutaneous system, and h) psychological system. The medical criteria for patient monitoring during F.E.S. exercise are discussed with respect to: a) cardiovascular monitoring, b) objective patient monitoring, and c) F.E.S. exercise system monitoring. The article concludes with a discussion of informed consent when applied to an emerging treatment modality.

Electric Stimulation Therapy↗
PubMed1986

Identification of the human T-lymphocyte protein-tyrosine kinase by peptide-specific antibodies.

We have recently cloned a cDNA from the human T-cell leukemia, JURKAT, having homology with the src-like family of protein-tyrosine kinases. We have made rabbit polyclonal antibodies against the synthetic peptide CKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP (cys-33-pro) deduced from the carboxy-terminal amino acid sequence predicted by the JURKAT cDNA. In this report, we demonstrate that these antibodies immunoprecipitate the protein-tyrosine kinase activity from solubilized membrane extracts from JURKAT T-leukemia cells and from human peripheral blood T-lymphocytes from normal donors. A 58 kd protein, exhibiting protein-tyrosine kinase activity, was specifically immunoprecipitated in both cases. The antibodies failed to crossreact with pp60c-src from human platelets, but did crossreact with the murine T-lymphocyte protein-tyrosine kinase, pp56T-cell.

Animals↗
PubMed1986

Human T lymphocytes express a protein-tyrosine kinase homologous to p56LSTRA.

We have used oligonucleotide probes, based on a portion of the p60v-src autophosphorylation sequence, Glu-Asp-Asn-Glu-Tyr-Thr, to identify and characterize a cDNA from the human T-leukemia cell line, JURKAT. The JURKAT cDNA (designated ptk-JURKAT) was homologous to but distinct from the src, yes and fgr oncogenes, which encode protein-tyrosine kinases (ATP:protein phosphotransferase, EC 2.7.1.37). The ptk-JURKAT cDNA hybridized with a 2.2 kb RNA transcript from JURKAT cells and the human T-cell lymphoma line, MOLT-4, but failed to identify any transcript in two human B-cell lymphoma lines or a human erythroid-myeloid leukemia line, K562. Recently the nucleotide sequence has been established for the murine lymphocyte protein tyrosine kinase, p56LSTRA. The ptk-JURKAT cDNA appears to encode the human homolog of p56LSTRA.

Amino Acid Sequence↗
PubMed1986

A computer model of neck muscle endurance and fatigue as a function of helmet loading.

A series of experiments were conducted in which the neck muscles of volunteer subjects were dynamically and statistically loaded by systematic variations of twenty-four headgear configurations consisting of eight different centers-of-gravity (CGs) times three different weights. Six subjects would rotate their heads laterally (from side-to-side) for 30 min with each of the headgear loading combinations. Immediately thereafter, the subject would position his head in an isometric head dynamometer and exert a sustained right lateral neck contraction or forward neck contraction at 70% of his maximum strength, during which endurance time (to fatigue) was recorded. The results indicate that the computer model makes reasonable predictions within the boundary conditions. Input data outside the boundary conditions is rejected. The assumption of insensitivity to vertical loading is demonstrated. The assumption of bilateral symmetric response was confirmed for the 1.45 kg and 2.27 kg helmet loads. However, this assumption was not confirmed for the 4.09 kg helmet load. It is concluded from the computer model that aftward, midline loading is the optimal CG location (i.e. maximal endurance) for heavier helmets in the 3-4 km range.

Adult↗
PubMed1985

Mechanisms involved in the vasodilator action of 5-hydroxytryptamine in the dog femoral arterial circulation in vivo.

The possibility that the vasodilator effect of 5-hydroxytryptamine (5-HT) in vivo involves a presynaptic inhibitory effect on sympathetic nerve activity was investigated in the femoral arterial circulation of pentobarbitone-anaesthetized dogs. The vasodilator effect of intraarterial (i.a.) 5-HT was abolished following ganglion blockade with mecamylamine, and remained inhibited after restoration of femoral vascular tone with i.a. ornipressin. These procedures had no effect on the vasodilator response to i.a. acetylcholine. The vasoconstrictor response to i.a. noradrenaline was not inhibited by mecamylamine. These findings suggest that a presynaptic inhibition of sympathetic neurotransmission is responsible for 5-HT-induced vasodilatation in vivo. Pizotifen (0.1-0.4 mg/kg i.v.) inhibited the 5-HT dilator response, but the doses required were too high to be commensurate with an action at 'D' type 5-HT receptors. Ketanserin (0.1-0.4 mg/kg i.v.) specifically inhibited the dilator response to 5-HT; higher doses (1-4 mg/kg i.v.) also inhibited noradrenaline-induced vasoconstriction. Ketanserin, at all doses used, reduced systemic blood pressure and femoral vascular resistance. The effects of the lower doses of ketanserin (0.1-0.4 mg/kg) cannot be due to peripheral alpha-adrenoceptor antagonism; blockade of the dilator effect of 5-HT may simply be due to inhibition of sympathetic nerve activity by ketanserin itself.

Animals↗
PubMed1985

Hypotensive actions of ketanserin in dogs: involvement of a centrally mediated inhibition of sympathetic vascular tone.

The intravenous (i.v.) administration of ketanserin (0.1-0.4 mg/kg) produced immediate and sustained decreases in systemic blood pressure and heart rate in pentobarbitone-anaesthetized dogs. These doses of ketanserin did not inhibit common carotid vasoconstrictor responses to intraarterial (i.a.) noradrenaline, pre-ganglionic stimulation of the sectioned cervical sympathetic nerve, or i.v. nicotine, thus the effects of ketanserin are not due to blockade of vascular alpha-adrenoceptors, adrenergic neurone blockade, or ganglionic blockade. Systemic pressor responses to i.v. nicotine, which produces sympathetic activation by both central and ganglionic stimulating actions, and to common carotid artery occlusion, were inhibited by 0.1-0.4 mg/kg of ketanserin i.v. These results suggest that in the anaesthetized dog, the hypotensive action of ketanserin involves a centrally mediated inhibition of sympathetic tone. Peripheral vascular 5-HT2 receptor blockade does not appear to be responsible for the hypotensive effect of ketanserin in this model, although this does not preclude the involvement of such a mechanism in its clinical antihypertensive action.

Animals↗
PubMed1985

The measurement of human endometrial prostaglandin production. A comparison of two in vitro methods.

Two in vitro methods for measuring human endometrial prostaglandin production were compared. Endometrial samples from eight patients were incubated over eight hours by a perifusion and a superfusion technique. The collected fractions were assayed by radioimmunoassay for PGE2 and PGF2 alpha. There was no significant difference between the perifusion and superfusion methods for the pattern and amount of PGE2 and PGF2 alpha production with time. Significantly higher production levels of PGE2 and PGF2 alpha were found in secretory phase endometria than in proliferative phase endometria. Histological examination of the tissue specimens by light and electron microscopy showed that both methods caused gross tissue damage after eight hours experimentation. The superfusion method produced more morphological damage than the perifusion method. However, no tissue damage could be detected after one hour of incubation with either method. Over an eight hour period neither the perifusion nor the superfusion technique appears to be a good indicator of in vivo endometrial prostaglandin production. Either technique used for only one to two hours may better reflect the in vivo situation.

Dinoprost↗
PubMed1985

Fractures of the hook of the hamate--a failure of clinical diagnosis.

Two cases of a fracture of the hook of the hamate are described in which the diagnosis was clinically missed even though a fracture of the hook was considered. In one patient, the clinical diagnosis was thought to be ulnar wrist instability, and in the other, a pisiotriquetral injury. In one case, the diagnosis was confirmed only by a computerized tomography scan even though lateral tomograms were negative.

Adult↗
PubMed1985

Evidence for a central component to the hypotensive action of ketanserin in the dog.

The mechanisms responsible for the hypotensive action of ketanserin are controversial. Vascular 5-HT2-receptor blockade, resulting in inhibition of serotonin-induced vasoconstriction and amplification of other vasoconstrictors, has been suggested by some investigators, but others have concluded that vascular alpha-adrenoceptor blockade is responsible. In our experiments using pentobarbitone-anaesthetized dogs, ketanserin (0.1-0.4 mg/kg i.v.) produced immediate and sustained falls in systemic arterial blood pressure and vascular resistance in the common carotid and femoral arterial circulations. Constrictor responses to noradrenaline in these circulations were unaffected by 0.1-0.4 mg/kg i.v. of ketanserin; alpha-adrenoceptor blockade was only produced by higher doses (1-4 mg/kg i.v.). Constrictor responses in the common carotid circulation to preganglionic cervical sympathetic nerve stimulation and to nicotine were not inhibited by 0.1-0.4 mg/kg of ketanserin. The systemic pressor responses to nicotine and common carotid artery occlusion, however, were reduced by these doses of ketanserin. These results suggest that alpha-adrenoceptor blockade is not responsible for the hypotensive action of 0.1-0.4 mg/kg of ketanserin, and that a centrally mediated inhibition of sympathetic nerve activity is involved.

Animals↗
PubMed1985

Discharge characteristics of motor units and the surface EMG during fatiguing isometric contractions at submaximal tensions.

The RMS amplitude of the surface electromyogram (EMG) and the frequency of discharge of motor units was examined throughout the duration of isometric contractions of the adductor pollicis muscles sustained to fatigue at tensions of 25, 40, and 55% of the maximum voluntary strength (MVC) of eight male subjects during fatiguing isometric contractions. The maximum strength of the muscle and the EMG above the adductor pollicis muscles was also assessed during 3 s of voluntary and electrically induced isometric contractions interposed at 25, 50, 75, and 100% of the duration of the fatiguing contractions. At the point of fatigue from submaximal isometric contractions, the RMS amplitude of the surface EMG was highest for contractions at 55 as compared to 40 and 25% MVC. The lower RMS amplitude of the EMG during contractions at lower as compared to higher tensions at the point of fatigue was paralleled by a lower discharge frequency of the alpha motor neurons in the fatigued muscle during contractions at 25% as compared to 40 and 70% MVC. The reduction in discharge frequency was probably of a sufficient order of magnitude to account for the lower amplitude of the EMG at the end of fatiguing isometric contractions at lower tensions.

Aerospace Medicine↗
PubMed1985

Closed-loop control of movement of skeletal muscle.

Closed-loop (feedback) control of skeletal muscle is critically reviewed. The introductory section examines the advantages and disadvantages of open-loop as compared to closed-loop control in general, defines the problem, and outlines our approach. In the biological systems section, muscle structure and function are defined at the level of the motor nerve, neuromuscular junction, and sarcomere. Time delays, power and efficiency, fatigue, and other effects are also discussed in relation to the development of closed-loop control. This section then proceeds to review biological sensors and finally integrates this information by reviewing the body's own closed-loop control system. The third section critically reviews various approaches to the mathematical modeling of muscle. The control problem (in general) is reviewed with particular emphasis on contemporary control systems engineering. Essential to closed-loop control of paralyzed skeletal muscle is sensor technology. Therefore, the fourth section reviews external mechanical sensors. Specifically, potentiometers and Hall effect sensors, capacitive force transducers, inductive displacement transducers (LVDTs), and various position resolvers are discussed. Finally, the fifth section reviews the application of closed-loop control of skeletal muscle to the human being. The focus of this section is the paralyzed individual: past progress and future directions. An extensive bibliography of cited references is then provided so that the interested reader may pursue his/her particular area of interest in more detail. The authors acknowledge that such an extensive review of so many relevant areas is necessarily not complete and often overly simplistic, but our goal is a "first approach" to a comprehensive understanding of the closed-loop (feedback) control problem for achieving movement in paralyzed skeletal muscle.

Animals↗